Из скольких аминокислот состоит белок: Сколько аминокислот содержит белок: виды и польза.

Содержание

Сколько аминокислот содержит белок: виды и польза.

Знания среднестатистического человека об аминокислотах достаточно ограничены. Многие знают лишь о том, что эти органические вещества содержатся в белках и без них невозможна нормальная деятельность организма.

Что это такое?

Аминокислоты (аминокарбоновые кислоты) – это стройматериал для белка, являющегося участником всех физиологических процессов, происходящих в организме. Из него состоят кости, мышцы, внутренние органы, ногти, волосы и другие составляющие человеческого тела.

Внимание! Белки имеют различный состав, поэтому не все из них одинаково полезны.

Сколько аминокислот входит в состав белка?

Белки представляют собой цепочку из аминокарбоновых кислот. Ученым потребовалось много десятилетний для поиска правильного ответа на вопрос о количестве аминокислот, входящих в состав белка.


Внимание! Установлено, что для нормальной жизнедеятельности организму человека необходимо двадцать протеиногенных аминокислот, которые принято называть мажорными.

Аминокислоты бывают заменимыми и незаменимыми. Первые синтезируются в самом организме, а вторые попадают туда извне вместе с пищей. Однако есть и относящиеся и к тому, и к другому разряду.

Заменимые аминокислоты

Эти аминокислоты продуцируются путем эндогенного синтеза из других веществ, поступающих вместе с пищей, в самом организме. Всего таких веществ двенадцать. Важнейшими из них являются:

  • аланин;
  • аргинин;
  • аспарагин;
  • аспарагиновая кислота.

Незаменимые аминокарбоновые кислоты

Аминокислоты этого типа оказываются в организме, попадая туда вместе с едой. В значительных количествах они присутствуют в белках животного происхождения и бывают восьми видов.

Лейцин

Восстанавливает мышцы, кожу и кости. Он участвует в продуцировании гормона роста, стабилизирует уровень сахара в крови и помогает сжигать жиры. Этого вещества много в мясе, орехах, бобовых. Оно содержится в нешлифованном рисе и зернах пшеницы и стимулирует синтез белка.


Внимание! Обеспечение организма лейцином важно тем, кто желает нарастить мышцы.

Изолейцин

Стимулирует выработку энергии. Его значительное количество присутствует в мясе, рыбе, орехах, яйцах, горохе и сое.

Эти продукты должны присутствовать в рационе спортсменов. После многочасовых интенсивных тренировок изолейцин помогает скорейшему восстановлению мышц, снимает крепатуру, участвует в образовании гемоглобина, а также регулирует количество сахара.

Лизин

Важен для иммунитета. Он участвует в синтезе защитных антител и выработке гормонов роста. Благодаря лизину обновляется костная ткань, и синтезируется коллаген.


Внимание! Лизин присутствует в яйцах, картофеле, мясе (за исключением белого мяса), рыбе и кисломолочных продуктах.

Фенилаланин

Содержится в орехах, грибах, курином мясе, молокопродуктах, бананах, абрикосах и топинамбуре. Оказывает влияние на деятельность центральной нервной системы.


Люди, у которых наблюдается недостаток фенилаланина в организме, подвержены депрессиям, им трудно концентрировать свое внимание, и у них наблюдаются проблемы с памятью.

Метионин

Помогает сжигать жир, повышает выносливость и работоспособность человека. Он присутствует в мясе, рыбе, кисломолочных продуктах, семенах подсолнечника, некоторых других продуктах.

Треонин

Оказывает влияние на сердце, сосуды, а также на нервную систему и иммунитет человека. Его много в молочных продуктах, овощах, мясе, грибах, злаках.


Внимание! При недостатке треонина наблюдаются проблемы с зубами и костями.

Триптофан

Обеспечивает синтез гормона счастья серотонина, а также регулирует давление. Его применяют для устранения негативных последствий употребления алкоголя и наркосодержащих веществ.

Валин

Регулирует мышечный метаболизм, используется для восстановления организма, активизации умственной деятельности, а также смягчает последствия употребления алкоголя и наркотиков. Он присутствует в мясе, сое, грибах, молокопродуктах и арахисе.


Теперь вам известно, сколько аминокарбоновых кислот присутствует в белках, и как они влияют на здоровье человека. Старайтесь следить за своим рационом и будьте здоровы!

Урок 12. аминокислоты. белки — Химия — 10 класс

Химия, 10 класс

Урок № 12. Аминокислоты. Белки

Перечень вопросов, рассматриваемых в теме: урок посвящён аминокислотам, их строению, номенклатуре, знакомству с пептидной группой и пептидной связью, химическими свойствами аминокислот, пептидам и полипептидам, знакомству с глицином как представителем аминокислот, биологической роли аминокислот, белкам, их структуре, химическим свойствам.

Глоссарий

Аминокислота – это азотсодержащее органическое соединение, в составе которой есть как аминогруппа, так и карбоксильная группа.

Белки – органические полимеры, в состав которых входят остатки аминокислот, соединённые пептидной связью. Количество аминокислотных остатков в белках обычно более 50.

Биуретовая реакция – качественная цветная реакция на пептидные связи. При добавлении к белку раствора щёлочи и сульфата меди (II) раствор приобретает красно-фиолетовую окраску.

Гидролиз белка – распад белка на отдельные аминокислоты в водном растворе кислот или щелочей.

Денатурация белка – разрушение вторичной, третичной и четвертичной структуры белка при нагревании, действии растворов солей тяжёлых металлов, кислот и щелочей. При денатурации белок сворачивается и выпадает в осадок.

Ксантопротеиновая реакция

– качественная цветная реакция концентрированной азотной кислоты с белками, содержащими остатки ароматических аминокислот. При добавлении концентрированной азотной кислоты к белку и нагревании сначала происходит денатурация белка, а затем появляется жёлтое окрашивание.

Олигопептиды – органические соединения, состоящие из 10–20 остатков аминокислот, связанных пептидными связями.

Пептидная группа – группа атомов в составе пептидов, состоящая из атомов углерода, кислорода, азота и водорода.

Пептидная связь – связь между атомами углерода и азота в пептидной группе.

Пептиды – органические соединения, состоящие из нескольких аминокислотных остатков, соединённых пептидной связью.

Полипептиды – макромолекулы, состоящие из 20–50 аминокислотных остатков, соединенных пептидной связью.

Основная литература: Рудзитис, Г. Е., Фельдман, Ф. Г. Химия. 10 класс. Базовый уровень; учебник/ Г. Е. Рудзитис, Ф. Г, Фельдман – М.: Просвещение, 2018. – 224 с.

Дополнительная литература:

1. Рябов, М.А. Сборник задач, упражнений и тестов по химии. К учебникам Г.Е. Рудзитис, Ф.Г. Фельдман «Химия. 10 класс» и «Химия. 11 класс»: учебное пособие / М.А. Рябов. – М.: Экзамен. – 2013. – 256 с.

2. Рудзитис, Г.Е. Химия. 10 класс : учебное пособие для общеобразовательных организаций. Углублённый уровень / Г.Е. Рудзитис, Ф.Г. Фельдман. – М. : Просвещение. – 2018. – 352 с.

Открытые электронные ресурсы:

  • Единое окно доступа к информационным ресурсам [Электронный ресурс]. М. 2005 – 2018. URL: http://window.edu.ru/ (дата обращения: 01.06.2018).

ТЕОРЕТИЧЕСКИЙ МАТЕРИАЛ ДЛЯ САМОСТОЯТЕЛЬНОГО ИЗУЧЕНИЯ

Аминокислоты – это азотсодержащие органические соединения, в состав которых входят как аминогруппа, так и карбоксильная группа

Простейшим представителем аминокислот является глицин – аминоуксусная (аминоэтановая) кислота

По международной номенклатуре нумерация углеродных атомов начинается от углерода карбоксильной группы.

Достаточно часто в литературе можно встретить обозначения углеродных атомов в аминокислотах с помощью букв греческого алфавита. При этом атом углерода карбонильной группы не имеет обозначения.

Для некоторых аминокислот существуют тривиальные названия.

Изомеры аминокислот различаются строением углеводородного радикала и положением аминогруппы.

Все α-аминокислоты, кроме глицина, имеют в своем составе асимметрический атом, который следует сразу за карбоксильной группой. У этого атома углерода все заместители разные.

Благодаря этому атому, для α-аминокислот характерна оптическая изомерия. В природе распространены только L-α-аминокислоты.

Биологическое значение аминокислот

Из аминокислот наибольшее значение имеют α-аминокислоты, так как они входят в состав белковых молекул, из которых построено всё живое вещество.

Растения и бактерии способны самостоятельно синтезировать все необходимые для них аминокислоты. Млекопитающие, в том числе и человек, не могут синтезировать ряд аминокислот, они должны поступать в организм с пищей. К таким незаменимым аминокислотам относятся метионин, треонин, фенилаланин, лейцин, изолейцин, валин, лизин, триптофан.

α-Аминокислоты необходимы человеку для образования белков. Большую часть аминокислот для этих целей человек получает с пищей. Некоторые аминокислоты можно синтезировать. Для регулирования обменных процессов аминокислоты применяются как лекарства (например, глицин).

Получение аминокислот

В промышленности α-аминокислоты получают гидролизом белков.

Можно синтезировать аминокислоты из хлорпроизводных карбоновых кислот и аммиака.

Cl-CH2-COOH + 2NH3 → NH2-CH2-COOH + NH4Cl

Физические и химические свойства аминокислот

Аминокислоты – кристаллические вещества без цвета и запаха, сладковатые на вкус. Хорошо растворяются в воде.

Аминокислоты – амфотерные соединения, так как аминогруппа проявляет основные свойства, а карбоксильная группа – кислотные.

Карбоксильная группа в составе аминокислот позволяет им реагировать со спиртами. В результате реакции образуются сложные эфиры.

Ион водорода от карбоксильной группы может переходить к аминогруппе, в результате образуется биполярный ион.

Пептиды

Аминокислоты могут реагировать друг с другом, аминогруппа одной кислоты соединяется с карбоксильной группой другой кислоты, при этом происходит выделение воды.

Группа атомов СО-NH называется пептидной (или амидной) группой, а связь между атомами углерода и азота – пептидной (амидной) связью.

Соединения, образованные из нескольких аминокислот с помощью пептидной связи, называются пептидами.

Называют пептиды перечислением тривиальных названий аминокислот, входящих в состав пептида, начиная с аминокислотного остатка со свободной аминогруппой (N-конец), заменяя в названии аминокислот окончание «ин» на «ил». Последней называют аминокислоту со свободной карбоксильной группой (С-конец), её название не изменяется. Часто название пептида записывают с помощью трёхбуквенных латинских сокращённых наименований аминокислот.

Молекулы, в состав которых входит 10–20 остатков аминокислот, называют олигопептидами.

Макромолекулы, образованные 20–50 остатками аминокислот называют полипептидами.

Полипептиды входят в состав многих гормонов. Нейропептиды регулируют работу мозга, процессы сна, обучения, обладают обезболивающим эффектом.

Белки

Полипептиды, содержащие в своём составе более 50 остатков аминокислот, называются белками. Это природные полимеры, которые образуют клетки всех живых организмов. Без белков невозможны обмен веществ, размножение и рост живых организмов.

Белки образованы атомами углерода, водорода, кислорода и азота. Кроме этих атомов, макромолекулы белков могут содержать атомы фосфора, серы, железа и других элементов.

Относительная молекулярная масса белковых молекул может быть от нескольких десятков до сотен атомных единиц массы.

Структура белков

Последовательность остатков аминокислот в молекуле белка образует первичную структуру белка.

Между атомом кислорода в группе С=О и атомом водорода в амидной группе – NH – образуется водородная связь, в результате чего макромолекула белка закручивается в спираль. Образуется вторичная структура белка.

Функциональные группы, расположенные на внешней стороне спирали, могут взаимодействовать с другими функциональными группами этой же макромолекулы. Например, между атомами серы образуется сульфидный мостик, между карбоксильной и гидроксильной группами возникает сложноэфирный мостик.

В результате образуется третичная структура белка, которая определяет специфическую биологическую активность белков. Именно благодаря уникальной третичной структуре биологические катализаторы – ферменты обладают уникальной избирательностью.

Благодаря различным функциональным группам белковые молекулы могут соединяться друг с другом, в результате формируется четвертичная структура белка.

Химические свойства белков

В зависимости от молекулярной массы и функциональных групп белки могут как хорошо растворяться в воде, так и не растворяться в ней.

Под действием температуры, растворов солей тяжёлых металлов, кислот и щелочей происходит разрушение вторичной, третичной и четвертичной структуры белка, называемое денатурацией.

При нагревании в присутствии кислоты или щёлочи белки подвергаются гидролизу, распадаясь на исходные аминокислоты.

Белки в щелочной среде в присутствии сульфата меди (II) окрашивают раствор в красно-фиолетовый цвет. Это реакция на пептидную группу (биуретовая реакция).

Концентрированная азотная кислота при нагревании окрашивает белки в жёлтый цвет, если в состав белка входят остатки ароматических аминокислот, например, фенилаланина (ксантопротеиновая реакция).

Для обнаружения в составе белка атомов серы проводят реакцию с ацетатом свинца в щелочной среде при нагревании. В результате образуется чёрный осадок (цистеиновая реакция).

Превращения белков в организме

Белки являются обязательными компонентами в пищевом рационе человека. В организме человека белки, поступившие с пищей, под действием ферментов подвергаются гидролизу и разлагаются на отдельные аминокислоты. Эти аминокислоты – строительный материал для образования новых белков, необходимых человеку. Для синтеза белков необходима энергия, которую поставляет в организме АТФ. Также энергия выделяется при распаде жиров и углеводов. Кроме синтеза белков происходит их распад с образованием углекислого газа, аммиака, мочевины и воды.

Успехи в изучении и синтезе белков

В 1954 г. британский биолог Фредерик Сенгер впервые расшифровал строение белка инсулина. Каждая молекула инсулина состоит из двух полипептидов, в одном из которых 21 остаток аминокислоты, а в другом – 30 аминокислотных остатков.

В 1967 г. был создан прибор – секвенатор, позволяющий определять последовательность остатков аминокислот в макромолекуле белка.

Первый белок, синтезированный в лаборатории в 1953 г. был окситоцин.

В настоящее время развивается наука, которая занимается синтезом искусственных белков, – генная инженерия.

ПРИМЕРЫ И РАЗБОР РЕШЕНИЙ ЗАДАЧ ТРЕНИРОВОЧНОГО МОДУЛЯ

1. Решение задачи на вычисление массовой доли элемента в молекуле аминокислоты.

Условие задачи: вычислите массовую долю азота в молекуле аспаргина

. Ответ запишите с точностью до десятых долей.

Шаг первый: вычислить относительную молекулярную массу молекулы аспаргина:

М = 4·12 + 8·1 + 2·14 + 3·16 = 132 а.е.м.

Шаг второй: определить количество атомов азота в молекуле аспаргина и определить их относительную атомную массу:

2·14 = 28 а.е.м.

Шаг третий: определить массовую долю азота как отношение относительной атомной массы азота к относительной молекулярной массе аспаргина:

(28 : 132)·100 = 21,2 %.

Ответ: 21,2.

2. Решение задачи на определение количества различных олигопептидов, которые можно получить из определённого набора аминокислот.

Условие задачи: Сколько ди- и трипептидов можно составить из двух молекул аланина и одной молекулы цистеина?

Шаг первый: определить количество возможных дипептидов.

Из двух молекул аланина и одной молекулы цистеина можно составить три дипептида: Ala-Ala, Ala-Cys и Cys-Ala (два последних дипептида – разные соединения, так как в молекуле Ala-Cys карбоксильная группа аланина соединяется с аминогруппой цистеина, а в молекуле Cys-Ala карбоксильная группа цистеина соединяется с аминогруппой аланина).

Шаг второй: определить количество возможных трипептидов.

Ala-Ala-Cys, Ala-Cys-Ala, Cys-Ala-Ala – возможно составить 3 трипептида.

Ответ: 3 дипептида и 3 трипептида.

Строение белков — урок. Химия, 8–9 класс.

Белки являются обязательной составной частью любого живого организма и играют важнейшую роль в обеспечении процессов жизнедеятельности.

 

В состав белков обязательно входят четыре химических элемента: углерод, водород, кислород и азот. Многие белки содержат серу. В состав некоторых входит фосфор. Есть белки, содержащие атомы металлов.

Белки — природные высокомолекулярные вещества (полимеры), состоящие из остатков аминокислот.

Аминокислотные остатки соединены в макромолекулах белков пептидной группой −NH−CO−, поэтому белки относят к полипептидам.

В состав белков входят двадцать аминокислот строения Nh3−C|H−COOHR.  Аминокислотные остатки соединяются в макромолекулы белков в различной последовательности. Число аминокислотных остатков в молекулах тоже может быть разное. Поэтому разнообразие белков практически безгранично и у каждого живого существа набор белковых молекул особый, неповторимый.

 

Белковые молекулы могут содержать от одного до нескольких сотен и даже тысяч аминокислотных остатков, поэтому их относительные молекулярные массы изменяются от десятков тысяч до нескольких миллионов. Так, относительная молекулярная масса гемоглобина равна \(68 000\), яичного белка — \(44 000\), а вируса гриппа — \(32 000 000\).

 

Свойства белка в первую очередь определяются порядком соединения аминокислотных остатков в полипептидной цепи.

Последовательность аминокислотных остатков в макромолекуле называется первичной структурой белка.

Первичная структура

  

Существуют вторичная (спираль) и третичная (клубок) структуры белковых молекул. Они образуются в результате внутримолекулярного взаимодействия частей полипептидной цепи.

 

Вторичная структура

  

Третичная структура

  

Несколько белковых молекул могут соединяться друг с другом и образовывать четвертичную структуру.

 

Четвертичная структура

Белки | Tervisliku toitumise informatsioon

Белки составляют примерно 15–20% массы тела человека, что при весе в 70 кг дает около 12 кг. Основные задачи белков – обеспечение роста, построения и развития организма. Белковый состав имеют почти все энзимы и часть гормонов. Белки активно участвуют в производстве антител и обеспечивают крепость и активность иммунной системы, а также участвуют в транспортировке многих соединений.

Белки состоят из аминокислот, подразделяемых на незаменимые, которые нужно получать с пищей, и заменимые, которые организм способен синтезировать самостоятельно. Незаменимыми для человека аминокислотами являются изолейцин, лейцин, лизин, метионин, фенилаланин, треонин, триптофан, валин и гистидин.  Заменимыми для человека аминокислотами являются аланин, аспарагин, аспарагиновая кислота, цистеин, глютамин, глютаминовая кислота, глицин, пролин, серин и тирозин. Разные продукты содержат разные сочетания и количества аминокислот.

Белки животного происхождения (белки яиц, молока, рыбы и мяса) содержат больше незаменимых аминокислот по сравнению с белками растительного происхождения. К сожалению, источники многих незаменимых животных белков слишком насыщены жиром. Довольно хороший аминокислотный состав имеют также белки, содержащиеся в сое, рисе, орехах и семенах.

В части белков (например, белках зерновых растений) недостает некоторых незаменимых аминокислот. Их дефицит можно компенсировать небольшим количеством белков животного происхождения, например, приготовить манную кашу на молоке, добавить в макароны сыр и т.д.

Белки выполняют в организме множество функций:
  • они необходимы для роста и строительства клеток организма,
  • почти все энзимы и часть гормонов имеют белковый состав,
  • активно участвуют в производстве антител и обеспечивают крепость и активность иммунной системы,
  • участвуют в транспортировке многих соединений,
  • дают пищевую энергию: 1 г = 4 ккал.

Рекомендуется покрывать белками 10–20 % суточной потребности в энергии. Человеку с потребностью в энергии 2000 ккал в сутки следует употреблять: от 0,1 x 2000 ккал / 4 ккал = 50 г до 0,20 x 2000 ккал/ 4 ккал = 100 г белков.

Лучшими источниками белков животного происхождения являются яйца, молочные продукты (например, творог, сыр, зернистый творог), рыба, птица, мясо. Лучшими источниками белков растительного происхождения являются бобовые, орехи, семена и зерновые продукты. Серьезный недостаток белка приводит к отекам и мышечной слабости, изменениям волос и кожи. Белковый дефицит часто возникает вместе с дефицитом энергии, обусловленным недостатком белков и других питательных веществ в результате общего дефицита питательных веществ.

Длительное питание продуктами с чрезмерным содержанием белка вредно, поскольку нагружает почки и печень, может вызвать подагру и повышает риск возникновения аллергии. Энергия, получаемая с белками, в долгосрочной перспективе не должна превышать 20 % суточной пищевой энергии.

введение для айтишников / Хабр

Приятно видеть, что хабравчане регулярно интересуется другими предметными областями – например, биологией (более конкретно – структурой и функцией биологических макромолекул). Однако некоторые посты (например,

этот

), вызывают у специалиста просто физическую боль из-за обилия совершенно диких фактологических ошибок. В этом посте мне хочется рассказать о структуре и функции белка. О том, что мы знаем и о том, чего не знаем, а так же об имеющихся в этой области вычислительных задачах, требующих решения и интересных IT-специалистам. Постараюсь рассказывать сжато и тезисно, чтобы информации было больше, а воды – меньше. Всех, интересующихся структурой белков, прошу под кат, там очень много букв.



1. Почему белки важны?

Как сказал Фридрих Энгельс, “Жизнь есть способ существования белковых тел”. В 19 веке еще не знали о роли ДНК в наследовании генетической информации, но утверждение дяди Фридриха в значительной мере справедливо до сих пор – основную работу в наших клетках совершают именно белки. Это и поддержание структуры (формы клеток), и химический катализ, и моторная функция (сокращение мышц, например), и транспорт (скажем, белок гемоглобин переносит кислород из легких в ткани и углекислый газ в обратном направлении) и сложные регуляторные функции по поддержанию постоянства внутренней среды (скажем, белковые гормоны и всякие внутриклеточные регуляторные системы) и многие другие. Словом, если в нашем организме что-то происходит, в это обязательно вовлечены белки (хотя и не только они).

2. Что такое белок?

С химической точки зрения белок – это линейный (неветвящийся) полимер, состоящий из монотонно повторяющихся одинаковых блоков «основной цепи», к которым приделаны различные «боковые группы». Так как блоки основной цепи несимметричны, вся полипептидная цепь белка имеет направление, различают N- и C-конец полипептидной цепи.


Длина цепи – от 70 до более чем 1000 мономеров (аминокислотных остатков), средняя длина для высших организмов – примерно 500-600 аминокислотных остатков, для бактерий эта величина будет меньше, скорее 300-400 остатков. Всего в природе существует 20 стандартных аминокислот, одинаковых и для бактерии и для человека, то есть из основной цепи могут торчать 20 разных боковых групп.


(Тут возможна поправка – некоторые химические группы могут быть модифицированны после синтеза белка, например, фосфорилированы. Однако это не рассматривается как другая аминокислота, а рассматривается как продукт модификации исходной. Так же у высших организмов возможно встраивание двух неканонических аминокислот, но это редкое событие. То есть, строго говоря, разных аминокислот 22, из них 20 основных и 2 редкие, плюс некоторые боковые группы могут быть изредка химически модифицированы).

Из поколения в поколение генетическая информация передается в виде ДНК, в ней есть так называемые «белок-кодирующие области». В этих местах ДНК однозначным образом (для ботанов – с точностью до альтернативного сплайсинга и редактирования РНК) закодирована информация о линейной последовательности аминокислот для синтеза данного белка, плюс в клетке есть соответствующие машины, способные синтезировать белок по информации, изначально закодированной в ДНК.

Так как белок – линейный полимер, собранный из 20 стандартных мономеров, его так называемую «первичную структуру» легко представить в виде строки, например так:

 
>small ubiquitin-related modifier 3 precursor [Homo sapiens]
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQG
LSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Это аминокислотная последовательность маленького человеческого белка в формате FASTA, первая строчка, начинающаяся с «>», описывает его название, после чего следует последовательность аминокислот в соответствии со стандартной кодировкой (например, М –метиони, S – серин и тд, всего 20 букв стандартного однобуквенного кода), слева – N-конец белка, справа – его С-конец. Для разных белков длина строки будет очевидно разной, так как белки имеют разную длину. Последовательности всех известных белков можно найти в открытом доступе здесь: www.ncbi.nlm.nih.gov

3. Структура белка

Хорошо, с первичной структурой разобрались, но разве белок работает в развернутом линейном виде? Конечно нет. Тут надо заметить, что со структурной точки зрения есть разные классы белков: глобулярные, мембранные и фибриллярные. Мембранные белки, как следует из названия, живут только в клеточных мембранах, для стабилизации их структуры нужно особое окружение мембраны, мы не будем их рассматривать в этом обзоре. Фибриллярные белки имеют простое регулярное строение, похожи на вытянутые волокна, они не растворимы в воде и выполняют структурные функции (например, из кератина состоят волосы, к фибриллярным белкам относится белок из натурального шёлка). Недавно стали выделять класс разупорядоченных белков – белков, не обладающих постоянной трехмерной структурой, либо приобретающих ее только на короткое время при взаимодействии с другими белками. Наиболее интересный с практической точки зрения класс белков, который мы и будем рассматривать – глобулярные водорастворимые белки, к этому классу относится большинство белков.

Линейная полипептидная цепь в воде способна самопроизвольно сворачиваться в сложную трехмерную структуру (глобулу) и только в таком свернутом виде белки могут выполнять химический катализ и прочую интересную работу. Поэтому нам принципиально важно знать именно трехмерную укладку белка, так как только на этом уровне становится понятно, как белок работает.

Вопрос: сколько трехмерных структур соответствует конкретному белку?
Ответ: Одна, с точностью до небольшой подвижности маленьких «разупорядоченных» петель. Известно ровно одно исключение, когда одной последовательности соответствуют 2 достаточно разные структуры, это прионы.

Вопрос: Почему у белка только одна трехмерная структура?
Ответ: для химического катализа нам нужно расположить соответствующие химические группы строго определенным образом в пространстве. Для этого нужна жесткая структура. То есть весь белок должен быть жестким, чтобы поддерживать химические группы аминокислот активного центра в нужных местах (в реальности многие белки состоят из двух и более жестких частей, которые могут двигаться друг относительно друга, это нужно для регуляции активности белка (аллостерическая регуляция), чтобы некий сигнал мог включать и выключать химическую активность белка-фермента). Чтобы структура была жесткой и стабильной, природа позаботилась о том, чтобы структура каждого белка соответствовала энергетическому минимуму данной системы атомов и этот минимум был настолько глубоким, чтобы белок из него не «выпрыгнул». Все другие, паразитные структуры, обладают большей энергией и белок все равно сваливается в энергетический минимум, соответствующий нативной структуре.

Вопрос: на чем держится трехмерная структура белка?
Ответ: если коротко, то в основном на большом количестве нековалентных взаимодействий. В принципе, химические группы белка могут образовывать: (1) водородную связь, эти группы есть и в основной цепи и у некоторых боковых групп, (2) ионную связь – электростатическое взаимодействие между разноименно заряженными боковыми группами, (3) Ван-дер-Ваальсово взаимодействие и (4) гидрофобный эффект, на котором держится общая структура белка. Суть в том, что в белке всегда есть гидрофобные ароматические остатки, им энергетически невыгодно контактировать с полярными молекулами воды, а выгодно «слипнуться» друг с другом. Таким образом, при сворачивании белка гидрофобные группы выталкиваются из водного окружения, «слипаясь» друг с другом и формируя «гидрофобное ядро», а полярные и заряженные группы, наоборот, стремятся в водное окружение, формируя поверхность белковой глобулы. Так же (5) боковые группы двух остатков цистеина могут образовать между собой дисульфидный мостик – полноценную ковалентную связь, жестко фиксирующую белок.

Соответственно, все аминокислоты делятся на гидрофобные, полярные (гидрофильные), положительно и отрицательно заряженные. Плюс цистеины, способные образовывать ковалентную связь между собой. Особыми свойствами обладают глицин – у него отсутствует боковая группа, сильно ограничивающая конформационную подвижность других остатков, поэтому он может очень сильно «гнуться» и находится в местах, где белковую цепь надо развернуть. У пролина же, наоборот, боковая группа образует кольцо, ковалентно связанное с основной цепью, жестко фиксируя ее конформацию. Пролины встречаются там, где надо сделать белковую цепь жесткой и негнущейся. Многие заболевания связаны с мутацией пролина на глицин, из-за чего структура белка слегка «плывет».

Вопрос: откуда вообще мы знаем о трехмерных структурах белка?
Ответ: из эксперимента, это абсолютно надежные данные.
Сейчас есть 3 метода для экспериментального определения структуры белка: ядерно-магнитный резонанс (ЯМР), cryo-EM (электронная микроскопия) и рентгеноструктурный анализ кристаллов белка.

ЯМР позволяет определить структуру белка в растворе, но он работает только для очень маленьких белков (для больших невозможно сделать деконволюцию).

Этот метод был важен для общего доказательства того, что у белка только одна трехмерная структура и что структура белка в кристалле идентична структуре в растворе. Это очень дорогой метод, так как требуется получить белок с изотопными метками.

Cryo-EM заключается в простой заморозке раствора белка и микроскопии. Минус метода – низкое разрешение (видна лишь общая форма молекулы, но не видно, как она устроена внутри), плюс плотность белка близка к плотности воды/растворителя, поэтому сигнал тонет в высоком уровне шума. В этом методе активно применяются компьютерные технологии работы с картинками и статистика для вытягивания сигнала из шума.

Отбираются миллионы картинок молекул белка, проводится разделение на классы в зависимости от ориентации молекулы относительно подложки, усреднение по классам, генерация eigenimages, новый раунд усреднения и так пока не сойдется. Потом из информации из разных классов можно восстановить трехмерный вид молекулы с низким разрешением. Если же есть внутренняя симметрия частиц (например, при cryo-EM анализе вирусов), то можно еще каждую частицу поусреднять в соответствии с операторами симметрии – тогда разрешение будет еще лучше, но хуже, чем в случае рентгеноструктурного анализа.

Рентгеноструктурный анализ – основной способ определения структур белка. Главный плюс – потенциально можно получить кристаллы даже очень больших комплексов из многих десятков белков (например, именно так была определена структура рибосомы – Нобелевская премия 2009 года). Минус метода – вначале нужно получить кристалл белка, но далеко не каждый белок хочет кристаллизоваться.

Зато после того, как кристалл получен, по дифракции рентгеновского излучения можно однозначно определить положения всех (упорядоченных) атомов в молекуле белка, этот метод дает самое высокое разрешение и позволяет в лучших случаях видеть позиции отдельных атомов. Было доказано, что структура белка в кристалле однозначно соответствует структуре в растворе.

Сейчас действует конвенция – если ты определил структуру белка любым из экспериментальных физических методов, структура должна быть помещена в открытый доступ в банк данных белковых структур (Protein Data Bank – PDB, www.pdb.org ), в настоящее время там находится более 90 000 структур (впрочем, многие из них повторяющиеся, например, комплексы одного и того же белка с разными малыми молекулами, такими, как лекарственные средства). В PDB все структуры лежат в стандартном формате, называющемся, внезапно, pdb. Это текстовый формат, в котором каждому атому структуры соответствует одна строчка, в которой указан номер атома в структуре, название атома (углерод, азот и тд), название аминокислоты, в которую входит атом, название цепи белка (A, B, C и тд, если это кристалл комплекса из нескольких белков), номер аминокислоты в цепи и трехмерные координаты атома в ангстремах относительно ориджина, плюс так называемые температурный фактор и заселённость (это сугубо кристаллографические параметры).

ATOM      1  N   HIS A  17     -12.690   8.753   5.446  1.00 29.32           N  
ATOM      2  CA  HIS A  17     -11.570   8.953   6.350  1.00 21.61           C  
ATOM      3  C   HIS A  17     -10.274   8.970   5.544  1.00 22.01           C  
ATOM      4  O   HIS A  17     -10.193   8.315   4.491  1.00 29.95           O  
ATOM      5  CB  HIS A  17     -11.462   7.820   7.380  1.00 23.64           C  
ATOM      6  CG  HIS A  17     -12.551   7.811   8.421  1.00 21.18           C  
ATOM      7  ND1 HIS A  17     -13.731   7.137   8.194  1.00 28.94           N  
ATOM      8  CD2 HIS A  17     -12.634   8.384   9.644  1.00 21.69           C  
ATOM      9  CE1 HIS A  17     -14.492   7.301   9.267  1.00 27.01           C  
ATOM     10  NE2 HIS A  17     -13.869   8.058  10.168  1.00 22.66           N  
ATOM     11  N   ILE A  18      -9.269   9.660   6.089  1.00 19.45           N  
ATOM     12  CA  ILE A  18      -7.910   9.377   5.605  1.00 18.67           C  
ATOM     13  C   ILE A  18      -7.122   8.759   6.749  1.00 16.24           C  
ATOM     14  O   ILE A  18      -7.425   8.919   7.929  1.00 18.80           O  
ATOM     15  CB  ILE A  18      -7.228  10.640   5.088  1.00 20.22           C  
ATOM     16  CG1 ILE A  18      -7.062  11.686   6.183  1.00 18.52           C  
ATOM     17  CG2 ILE A  18      -7.981  11.176   3.889  1.00 24.61           C  
ATOM     18  CD1 ILE A  18      -6.161  12.824   5.749  1.00 28.21           C  
ATOM     19  N   ASN A  19      -6.121   8.023   6.349  1.00 15.46           N  
ATOM     20  CA  ASN A  19      -5.239   7.306   7.243  1.00 14.34           C  
ATOM     21  C   ASN A  19      -4.012   8.178   7.507  1.00 14.83           C  
ATOM     22  O   ASN A  19      -3.431   8.715   6.575  1.00 18.03           O  
ATOM     23  CB  ASN A  19      -4.825   6.003   6.573  1.00 17.71           C  
ATOM     24  CG  ASN A  19      -6.062   5.099   6.413  1.00 21.26           C  
ATOM     25  OD1 ASN A  19      -6.606   4.651   7.400  1.00 26.18           O  
ATOM     26  ND2 ASN A  19      -6.320   4.899   5.151  1.00 31.73           N  

Далее есть специальные программы, которые по данным из этого текстового файла могут графически отображать красивую трехмерную структуру молекулы белка, которую можно покрутить на экране монитора и, как говорил Гай Додсон, «дотронуться мышкой до молекулы» (например, PyMol, CCP4mg, старый RasMol). То есть смотреть на структуры белка просто – ставишь программу, загружаешь нужную структуру из PDB и наслаждаешься красотой природы.

4. Анализируем структуру

Итак, мы поняли основную идею: белок — линейный полимер, сворачивающийся в водном растворе под действием множества слабых взаимодействий в стабильную и единственную для данного белка трехмерную структуру, и способный в таком виде выполнять свою функцию. Различают несколько уровней организации белковых структур. Выше мы уже познакомились с первичной структурой – линейной последовательностью аминокислот, которую можно выписать в строчку.


Вторичная структура белка определяется взаимодействием атомов основной цепи белка. Как уже было сказано выше, в состав основной цепи белка входят доноры и акцепторы водородной связи, таким образом, основная цепь может приобретать некоторую структуру. Точнее, несколько разных структур (детали все-таки зависят от различающихся боковых групп), так как возможно образование разных альтернативных водородных связей между группами основной цепи. Структуры бывают такие: альфа-спираль, бета-листы (состоящие из нескольких бета-тяжей), которые бывают параллельными и анти-параллельными, бета-поворот. Плюс часть цепи может и не иметь выраженной структуры, например в районе поворота петли белка. Эти типы структур имеют свои устоявшиеся схематичные обозначения – альфа-спираль в виде спирали или цилиндра, бета-тяжи в виде широких стрелок. Вторичную структуру удается достаточно достоверно предсказывать по первичной (стандартом является JPred), альфа-спирали предсказываются наиболее точно, с бета-тяжами бывают накладки.

Третичная структура белка определяется взаимодействием боковых групп аминокислотных остатков, это и есть трехмерная структура белка. Можно представить себе, что вторичная структура сформирована и теперь эти спирали и бета-тяжи хотят уложиться все вместе в компактную трехмерную структуру, чтобы все гидрофобные боковые группы спокойно «слиплись» вместе в глубине белковой глобулы, сформировав гидрофобное ядро, а полярные и заряженные остатки торчали наружу в воду, формируя поверхность белка и стабилизируя контакты между элементами вторичной структуры. Третичную структуру изображают схематически несколькими способами. Если просто отрисовать все атомы, то получится каша (хотя когда мы анализируем активный центр белка, то мы хотим смотреть как раз на все атомы активных остатков).

Если мы хотим посмотреть, как устроен весь белок в общем, можно отобразить только некоторые атомы основной цепи, чтобы увидеть ее ход. Как вариант, можно нарисовать красивую схему, где поверх реального расположения атомов схематично нарисованы элементы вторичной структуры – так с первого взгляда видна укладка белка. После изучения всей структуры в общем, схематичном виде, можно отобразить химические группы активного центра и уже сосредоточиться на них. Задача предсказания третичной структуры белка – нетривиальная и в общем случае не решается, хотя может быть решена в частных случаях. Подробнее – ниже.

Четвертичная структура белка – да, есть и такая, правда не у всех белков. Многие белки работают сами по себе (мономеры, в данном случае под мономером имеется в виду одиночная свернутая полипептидная цепь, то есть белок целиком), тогда их четвертичная структура равна третичной. Однако достаточно много белков работает только в комплексе, состоящем из нескольких полипептидных цепей (субъединиц или мономеров — димеры, тримеры, тетрамеры, мультимеры), тогда вот такая сборка из нескольких отдельных цепей и называется четвертичной структурой. Самый банальный пример – состоящий из 4 субъединиц гемоглобин, самый красивый на мой взгляд пример – состоящий из 11 одинаковых субъединиц бактериальный белок TRAP.

5. Вычислительные задачи

Белок – сложная система из тысяч атомов, поэтому без использования компьютеров в структуре белка не разобраться. Задач, как решенных на приемлемом уровне, так и совсем не решенных, множество. Перечислю наиболее актуальные:

На уровне первичной структуры – поиск белков с похожей аминокислотной последовательностью, построение по ним эволюционных деревьев и тд – классические задачи биоинформатики. Главным хабом является NCBI — The National Center for Biotechnology Information, www.ncbi.nlm.nih.gov. Для поиска белков со сходной последовательностью стандартно используется BLAST: blast.ncbi.nlm.nih.gov/Blast.cgi

Предсказание растворимости белка. Речь идет о том, что если мы прочитаем геном какого-нибудь животного, определим по нему последовательности белков, переклонируем эти гены в кишечную палочку или baculovirus expression system, то окажется, что при экспрессии в этих системах примерно треть белков не будет сворачиваться в правильную структуру, и, как следствие, будет нерастворима. Тут выясняется, что большие белки на самом деле состоят из отдельных «доменов», каждый из которых представляет автономную, функциональную часть белка (несущую одну из его функций) и часто «вырезав» из гена отдельный домен, можно получить растворимый белок, определить его структуру и провести с ним опыты. Люди пытаются использовать машинное обучение (нейронные сети, SVM и прочие классификаторы), чтобы предсказывать растворимость белка, однако работает оно достаточно плохо (Гугл много чего покажет по запросу “protein solubility prediction” – есть много серверов, но по моему опыту все они работают отвратительно на моих белках). В идеале я хотел бы видеть сервис, который надежно сказал бы, где в белке находятся те самые растворимые домены, чтобы их можно было вырезать и работать с ними – такого сервиса нет.

На уровне вторичной структуры – предсказание той самой вторичной структуры по первичной (JPred)

На уровне третичной структуры – поиск белков со сходными трехмерными структурами (DALI, en.wikipedia.org/wiki/Structural_alignment ),
Поиск структур по заданной суб-структуре. Например, у меня есть расположение трех аминокислот активного центра в пространстве. Хочу найти структуры, которые содержать такие же три аминокислоты в таком же относительном расположении, либо найти структуры белков, мутирование которых даст возможность расположить нужные аминокислоты нужным образом. (гуглить «protein substructure search»)
Предсказание потенциальной подвижности трехмерной структуры, возможных конформационных изменений – normal mode analysis, ElNemo.

На уровне четвертичной структуры – предположим, известны структуры двух белков. Известно, что они образуют комплекс. Предсказать структуру комплекса (определить, как эти два белка будут взаимодействовать посредством shape matching, например). Гуглить «protein-protein docking»

6. Предсказание структуры белка

Выделил эту вычислительную задачу в отдельный раздел, ибо велика она, фундаментальна и не решается в общем случае.

Экспериментально мы знаем, что если взять белок, полностью развернуть его и бросить в воду, то он свернется обратно в исходное состояние за время от миллисекунд до секунд (это утверждение справедливо по крайней мере для небольших глобулярных белков без всяких патологий). Это значит, что вся информация, необходимая для определения трехмерной структуры белка, в неявном виде содержится в его первичной последовательности, поэтому так хочется научиться предсказывать трехмерную структуру белка по последовательности аминокислот in silico! Однако эта задача в общем случае не решена до сих пор. В чем же дело? Дело в том, что в первичной последовательности отсутствует в явном виде информация, необходимая для построения структуры. Во-первых, нет информации о конформации основной цепи – а она обладает значительной подвижностью, хотя и несколько ограниченной по стерическим причинам. Плюс каждая боковая цепь каждой аминокислоты может находиться в разных конформациях, для длинных боковых групп типа аргинина, это может быть больше десятка конформаций.

Что же делать? Есть достаточно известный хабравчанам самый общий подход, называемый «молекулярная динамика» и подходящий для любых молекул и систем. Берем развернутый белок, приписываем всем атомам случайные значения скоростей, считаем взаимодействия между атомами, повторяем до тех пор, пока система не придет в стабильное состояние, соответствующее свернутому белку. Почему это не работает? Потому что современные вычислительные мощности позволяют за месяцы работы кластера считать десятки наносекунд для системы из тысяч атомов, какой является белок, помещенный в воду. Время же сворачивания белка – миллисекунды и больше, то есть вычислительных мощностей не хватает, разрыв – в несколько порядков. Впрочем, пару лет назад американцы совершили некоторый прорыв. Они использовали специальное железо, оптимизированное для векторных вычислений и после оптимизации на аппаратном уровне у них за месяцы работы машины получилось посчитать молдинамику до миллисекунд для очень маленького белка и белок свернулся, структура соответствовала экспериментально определенной ( http://en.wikipedia.org/wiki/Anton_(computer) )! Однако праздновать победу еще рано. Они взяли очень маленький (его размер раз в 5-10 меньше среднего белка) и один из самых быстросворачивающихся белков, классический модельный белок, на котором изучалось сворачивание. Для больших белков время расчетов увеличивается нелинейно и потребуются уже годы, то есть еще есть над чем работать.

Другой подход реализован в Rosetta. Они разбивают последовательность белка на очень короткие (3-9 остатков) фрагменты и смотрят, какие конформации для этих фрагментов присутствуют в PDB, после чего запускают Монте-Карло по всем вариантам и смотрят, что получится. Иногда получается что-то годное, но в моих случаях через несколько дней работы кластера получаешь такой бублик, что возникает немой вопрос: «Кто писал их оценочную функцию, ставящую какую-то хорошую оценку вот этой загогулине?».

Есть инструменты и для моделирования вручную – можно предсказать вторичную структуру и попробовать вручную крутить ее, находя лучшую укладку. Некие гениальные люди даже выпустили игрушку FoldIt, представляющую белок схематично и позволяющую укладывать его, как-бы собирая головоломку (для интересующихся структурой – рекомендую!). Есть абсолютно официальное соревнование для предсказателей белковых структур, называемое CASP. Суть в том, что когда экспериментаторы определяют новую структуру белка, не имеющую аналогов в PDB, они могут не выкладывать ее сразу в PDB, а выставить последовательность этого белка на конкурс предсказаний CASP. Через некоторое время, когда все закончат свои предсказательные модели, экспериментаторы выкладывают свою экспериментально определенную структуру белка и смотрят, насколько хорошо сработали предсказатели. Самое интересное, что игроки FoldIt, не будучи учеными, как-то выиграли CASP у профессионалов моделирования белковых структур и предсказали структуру белка точнее. Однако даже эти успехи не позволяют утверждать, что проблема предсказания структуры белка решается – очень часто модель очень далека от реальной структуры.

Все это относилось к моделированию белков ab initio, когда нет никакой априорной информации о структуре. Однако очень часто бывают ситуации, когда для некоторого белка в PDB присутствует его отдаленный родственник с уже известной структурой. Под родственником подразумевается белок с похожей первичной последовательностью. Считается, что для белков со сходством по первичной последовательности больше 30% одинаковая укладка основной цепи (хотя одинаковая укладка наблюдалась и для белков, не проявляющих никакого статистически достоверного сходства по первичной последовательности). В случае наличия гомолога (похожего белка) с известной структурой, можно сделать «гомологичное моделирование», то есть попросту «натянуть» последовательность твоего белка на известную структуру гомолога, а потом погонять минимизацию энергии, чтобы как-то все это дело утрясти. Такое моделирование показывает хорошие результаты при наличие очень близких гомологов, чем дальше гомолог – тем больше ошибка. Инструменты для гомологичного моделирования – Modeller, SwissModel.

Можно решать и другие задачи, например, пытаться моделировать, что произойдет, если внести в белок ту или иную мутацию. Например, если заменить гидрофильную аминокислоту на поверхности белка на другую гидрофильную, то скорее всего структура белка не изменится вообще. Если заменить аминокислоту из гидрофобного ядра на другую гидрофобную, но другого размера, то скорее всего укладка белка останется той же, но слегка «съедет» на доли ангстрема. Если же заменить аминокислоту из гидрофобного ядра на заряженную, то скорее всего белок просто «взорвется» и не сможет свернуться.

Может показаться, что все не так уж и плохо и мы достаточно хорошо пониманием сворачивание белка. Да, мы понимаем кое-что, например до некоторой степени мы понимаем общие физические принципы, лежащие в основе сворачивания полипептидной цепи – они рассматриваются в замечательном учебнике Птицына и Финкельштейна «Физика белка». Однако это общее понимание не позволяет нам ответить на вопросы «Свернется ли данный белок или не свернется?», «Какая структура будет у этого белка?», «Как сделать белок с желаемой структурой?».

Вот одна из иллюстраций: мы хотим локализовать один из доменов большого белка, это стандартная задача. У нас есть фрагмент, который сворачивается и растворим, то есть это живой и здоровый белок. Мы же хотим найти его минимальную часть и начинаем методами генетической инженерии с обоих концов удалять по 2-3 аминокислоты, экспрессировать такой обрезанный белок в бактерии и смотреть его сворачиваемость экспериментально. Мы делаем десятки конструкций с такими маленькими делециями и видим такую картину – полностью растворимый и живой белок отличается от полностью мертвого и несворачивающегося на 3 аминокислоты. Повторюсь, это объективный экспериментальный результат. Проблема в том, что сейчас не существует вычислительного метода, который предсказал бы сворачиваемость белка хотя бы на уровне «да/нет» и сказал мне, где проходит граница между сворачивающимся и несворачивающимся белком, потому мы вынуждены клонировать и экспериментально проверять десятки вариантов. Это лишь одна из иллюстраций того, что наше понимание структуры белка весьма далеко от совершенства. Как говорил Ричард Фейнман, «Чего не могу воссоздать, того не понимаю».

Так что, господа программисты, физики и математики, нам еще есть над чем работать.

На этой оптимистичной ноте разрешите откланяться, благодарю всех, кто осилил сей опус.

Для глубоко знакомства с предметной областью рекомендую следующий минимум:
1) «Физика белка» Птицын и Финкельштейн. Большую часть материала Алексей Витальевич Финкельштейн выложил в онлайн, чем и рекомендую с благодарностью воспользоваться: phys.protres.ru/lectures/protein_physics/index.html (а я утащил оттуда несколько картинок)
2) Патрушев, «Искусственные генетические системы», особенно часть II «Белковая инженерия». Есть на торрентах в формате Djvu
3) Для информации, опубликованной в биологических научных журналах, есть официальный поисковик PubMed ( www.pubmed.org ) — у него стоит попросить почитать про «protein engineering» и тому подобное.

Сколько аминокислот будет содержать белок, если ген, кодирующий его, состоит из 1200

Почему у голосеменных растений средней полосы не происходит листопада? Развёрнуто

Вставьте пропущенные слова

Дайте определение понятиямКратко

15 балловХвойные сосна обыкновенная, подпишите картинку

Главными органами выделения у человека являются почки. Через почки удаляется до 75% выводимых из организма продуктов обмена веществ. С мочой выделяетс … я избыток воды, солей и продуктов распада белков (мочевина, мочевая кислота и др.), попавшие в кровь чужеродные вещества, в том числе и некоторые лекарственные препараты. С помощью почек в организме поддерживается оптимальная реакция (рН), постоянный объём воды и солей, стабильное осмотическое давление. Таким образом, почки вместе с другими органами поддерживают постоянство состава внутренней среды организма — гомеостаз. Организм человека редко допускает ошибки. Если ошибка случается, то это признак серьёзного заболевания или воспаления. Как же организм справляется с проблемой выделить все ненужные продукты обмена, опасные вещества, а необходимые витамины, аминокислоты и другие питательные вещества оставить в организме? Как организм справляется с сортировкой мусора?

Определи все верные ответы. Особенность безусловных рефлексов заключается в том, что они: -являются признаком, характерным для отдельной особи вида; — … являются врождёнными; -не передаются по наследству; -возникают в результате многократного повторения; -обеспечивают приспособление организма к постоянным условиям среды; -обеспечивают приспособление организма к меняющимся условиям окружающей среды.

Какие препараты относятся к категории и содержат масла в воде, или воду в масле?​

У всех ли организмов с трехкамерным и более сердцем левая половина заполнена артериальной кровью, а правая венозной? есть ли организмы, у которых наоб … орот?​

назовите любой вид хордовых ​

как происходит симбиоз между кроликом и чёрной пантерой?​

Белки в организме человека — всё, что нужно о них знать

Содержание:

Что такое белки? Это питательные вещества, необходимые для роста и восстановления клеток, а также для правильного функционирования организма. Они находятся во всем теле – в мышцах, костях, коже, волосах и тканях. Поскольку наше тело не способно накапливать белок, важно ежедневно получать достаточное его количество в пище. В этой статье расскажем о том, сколько белков нужно потреблять, в каких продуктах они содержатся и какие функции выполняют.

Белки состоят из аминокислот, которые являются их строительными блоками. Часть из них наш организм способен вырабатывать самостоятельно, они называются заменимыми. А также есть аминокислоты, которые могут быть получены только благодаря определенным продуктам, так как тело не способно их синтезировать. Как вы могли догадаться, они получили название незаменимых. К ним относятся:

  • гистидин
  • изолейцин
  • лейцин
  • лизин
  • метионин
  • фенилаланин
  • треонин
  • триптофан
  • валин

В свою очередь белки делятся на полноценные и неполноценные.

Полноценными считаются те, в чьем составе есть все незаменимые аминокислоты. Их содержат продукты преимущественно животного происхождения: мясо, птица, яйца, молочные и кисломолочные продукты.

К неполноценным относятся белки, в которых отсутствует хотя бы одна из вышеперечисленных незаменимых аминокислот. Как можно понять из названия, главным источником данного вида белка являются овощи, фрукты, бобовые, крупы, злаки, орехи и пр.

Отличие полноценных и неполноценных белков и продукты, в которых они содержатся

Функции белка в организме

Для чего нужны белки? Наряду с жирами и углеводами, они играют важную роль в работе организма, выполняя следующие функции:

  • Строительную. Белки являются основным структурным материалом всех клеточных мембран. 
  • Каталитическую. Практически все биохимические реакции протекают благодаря белками-ферментам. Например, пепсин – пищеварительный фермент в желудке, помогает расщеплять белки после употребления еды.
  • Двигательную, ведь работа мышц, костей, наше общее состояние напрямую зависит от потребления белков.
  • Транспортную. Например, гемоглобин транспортирует кислород через кровь.
  • Защитную. Антитела – это белки, вырабатываемые иммунной системой, которые помогают выявлять патогены и бороться с инфекциями.
  • Гормональную. Белки гормонов координируют функции организма, например, инсулин контролирует концентрацию сахара в крови, регулируя поглощение глюкозы клетками.
  • Пластическую. Например, коллаген и эластин играют немаловажную роль для соединительных тканей.
  • Рецепторную. Белки играют важную роль в межклеточных связях и передаче сигналов.

Значение и функции белков в организме человека

Сколько белка нужно потреблять в сутки?

Согласно исследованиям, ученые рекомендуют потреблять в день такое соотношение белков – 0,8 г на 1 кг вашего веса. Таким образом, человек с весом 70 кг должен получать не меньше 56 грамм белка в сутки.

Но этот показатель все же относителен, так как люди, ведущие активный образ жизни и регулярно посещающие спортзал, нуждаются в их большем количестве. Также исследования утверждают, что потребление белков выше нормы идет на пользу пожилым людям, ведь они склонны к потере мышечной массы.

При этом не забывайте учитывать общую формулу соотношения белков, жиров и углеводов. В рационе должно быть 25-35% белков, 25-35% жиров и 30-50% углеводов.

Усредненная формула соотношения белков, жиров и углеводов в дневном рационе

Отличие белков растительного и животного происхождения

Животные белки – те, что содержатся в продуктах, которые мы получаем благодаря домашнему скоту и рыбной ловле (различные виды мяса и птицы, рыба и морепродукты, яйца, молочная и кисломолочная продукция). Они считаются полноценными источниками белка в еде, так как содержат все незаменимые аминокислоты, необходимые организму для эффективного функционирования:

  • Витамин B12. Принимает участие в синтезе ДНК и формировании нервных волокон. 
  • Витамин D. Содержится в жирной рыбе, яйцах и молочных продуктах и лучше усваивается в данном виде, хотя его содержат и некоторые растения. Участвует в обмене веществ и способствует лучшему усвоению кальция.
  • Докозагексаеновая кислота (ДГК) – это важный компонент омега-3, содержащийся в жирной рыбе. Он полезен для работы мозга и его трудно получить из растительных источников.
  • Гемовое железо. Содержится в мясе (преимущественно красном), печени и рыбе. Оно помогает в процессе обмена кислородом, влияет на общее самочувствие и работу мозга. 
  • Цинк. Содержится в источниках животного белка, таких как говядина, свинина и баранина. От него зависит состояние кожи, волос, ногтей и каким будет процесс обновления клеток.

Учтите, что не все мясо полезно. Например, красное необработанное мясо говядины, свинины, баранины, телятины, следует употреблять в ограниченном количестве. 

Также избегайте обработанного мяса (бекон, сосиски, колбасы, мясное ассорти).

Продукты, содержащие белки растительного и животного происхождения

В отличие от белков животного происхождения, растительные содержатся в бобах, орехах, крупах, овощах, соевых продуктах и пр. Они считаются неполноценными, поскольку в них отсутствует одна или несколько незаменимых аминокислот, которые нужны организму. Чаще всего им не хватает метионина, триптофана, лизина и изолейцина. Именно поэтому диетологи и врачи настаивают на сбалансированном питании, чтобы получать полный комплекс питательных веществ.

Могут ли веганы и вегетарианцы получать необходимое количество белка только из продуктов растительного происхождения? Да. Кроме того, исследования показывают, что благодаря этому вегетарианцы зачастую имеют меньшую массу тела, более низкий уровень холестерина и артериального давления.

Источники растительного белка для вегетарианцев

Если вы не употребляете продукты животного происхождения, ваша главная задача – подобрать рацион, который обеспечит организм всеми необходимыми компонентами.

Вы должны учесть, что, например, рис содержит слишком мало лизина, чтобы считаться полноценным источником белка. Но употребляя его с фасолью или салатом с чечевицей, вы получите все девять незаменимых аминокислот.

Какие продукты растительного происхождения содержат большое количество белков?
  • Киноа – это зерно без глютена, которое содержит 8 граммов белка на 1 приготовленную чашку (185 граммов). В состав крупы входит множество полезных минералов, в том числе магний, железо и цинк.
  • Тофу – сыр, который изготавливается из соевого молока. Употребление 85 г дает приблизительно 8 г белка. Содержит кальций, калий и железо.
  • Гречневая крупа. Одна чашка (168 грамм) вареной гречневой крупы дает приблизительно 6 грамм белка. Является источником многих важных минералов, включая фосфор, марганец, медь, магний и железо.
  • Спирулина – разновидность сине-зеленых водорослей, 1 столовая ложка (7 г) высушенной спирулины дает 4 г белка. Она богата антиоксидантами и является источником нескольких витаминов группы В, меди и железа.
  • Семена чиа. Две столовые ложки (28 г) семян дают 4 грамма белка. Является хорошим источником Омега-3, железа, кальция, магния и селена.
  • Рис и бобы – классическое сочетание, которое является источником полноценного белка. Одна чашка (239 г) риса и бобов дает 12 г белка и 10 г клетчатки.
  • Орехи. Например, 30 г миндаля дает 6 граммов белка, почти столько же содержится в 30 г жареного стейка рибай.

Продукты растительного происхождения, содержащие много белка

Зачем потреблять продукты, содержащие белок?

Исследования показывают, что высокое потребление белка увеличивает пищевой термогенез – энергию, которая тратится организмом на поглощение, переваривание и усвоение пищи. А также дарит чувство сытости и наполненности, ведь белок снижает уровень гормона голода – грелина. Кроме того, поддерживает надлежащий уровень pH и баланса жидкости.

Употребление достаточного количества белка помогает поддерживать мышечную массу и способствует росту мышц при регулярных силовых тренировках. Способствует снижению кровяного давления, которое является причиной сердечных приступов, инсультов и хронических заболеваний. Формирует иммуноглобулины (антитела) для борьбы с разными инфекциями.

Большинство долгосрочных исследований показывают, что растительный и животный белок приносит пользу для здоровья костей, сохраняя костную массу с возрастом и сокращая риски получения переломов.

Аминокислоты участвуют абсолютно во всех процессах, происходящих в организме, поэтому потребление белков крайне важно для полноценной его работы.

Белки в составе организма

Дефицит белка может привести к следующим последствиям:

Симптомы дефицита белка включают в себя:

  • истощение мышечной ткани
  • отеки (чаще всего жидкость накапливается в ногах и лодыжках)
  • анемия (неспособность крови доставлять достаточное количество кислорода в клетки)
  • медленный рост у детей и пр.

Низкий уровень белка также может быть признаком других серьезных проблем, связанных с печенью, почками или сердцем.

Телу важно получать все аминокислоты, ведь каждая из них выполняет разные функции и недостаток тех или иных компонентов рано или поздно может негативно сказаться на самочувствии. 

Помогает ли употребление белковой пищи в процессе похудения?

Есть много преимуществ, связанных с высоким потреблением белка в процессе похудения:

    • Предотвращает потерю мышечной массы на диете с ограничением калорий. Наверное, все слышали, что для тех, кто хочет иметь рельефное тело с четко прорисованными мышцами, рекомендуют после тренировки употреблять молочные шейки, творог, яйца или протеиновые коктейли.
    • Исследования показывают, что белок увеличивает расход энергии больше, чем любой другой макроэлемент.
    • Увеличение потребления белка приводит к ощущению сытости, меньшему количеству перекусов, снижению потребления калорий и в результате – к потере веса.
    • Замена углеводов и жиров белком предотвращает ожирение и ускоряет метаболизм, увеличивая количество сжигаемых калорий на 80-100 в день больше обычного. 
    • Белковое питание помогает не только сбросить вес, но и удержать результат в долгосрочной перспективе. В одном из исследований, которое длилось год, 130 испытуемых с избыточным весом придерживались разных диет, одни ограничили себя в потребляемых калориях, а другие – повысили содержание белка в рационе. В результате вторая группа потеряла на 53% больше жира, чем первая.

Самое главное, что в отличие от жиров и углеводов, в случае с белками, вам не нужно ограничивать себя в их потреблении. Такая диета не об ограничениях, а о сбалансированности, поэтому вызывает гораздо меньше стресса у организма.

20 аминокислот, входящих в состав белков | Улучшение жизни с помощью аминокислот | О нас | Глобальный веб-сайт Ajinomoto Group

Как известно, различные аминокислоты являются основными компонентами, из которых состоят белки. Аминокислоты составляют важную часть человеческого тела и диеты. Они чрезвычайно важны для правильного функционирования человеческого тела; следовательно, важно понимать, сколько аминокислот составляют белки. Давайте перейдем к выяснению, сколько аминокислот действительно составляют белки.

Сколько аминокислот помогает вырабатывать белки?

В природе идентифицировано около 500 аминокислот, но только 20 аминокислот составляют белки, обнаруженные в организме человека. Давайте узнаем обо всех этих 20 аминокислотах и ​​типах различных аминокислот.

Типы всех аминокислот

Все 20 аминокислот подразделяются на две разные аминокислотные группы. Незаменимые и заменимые аминокислоты вместе составляют 20 аминокислот.Из 20 аминокислот 9 являются незаменимыми аминокислотами, а остальные — заменимыми аминокислотами. Давайте посмотрим на каждую аминокислоту в соответствии с их классификацией.

Незаменимые аминокислоты

BCAA (валин, лейцин и изолейцин)

Аминокислоты с разветвленной цепью (BCAA) представляют собой группу из трех аминокислот (валин, лейцин и изолейцин), которые имеют молекулярную структуру с разветвлением. BCAA богаты мышечными белками, стимулируют рост мышц в организме и обеспечивают энергию во время упражнений.

Лизин

Лизин — одна из наиболее часто упоминаемых незаменимых аминокислот. Такие продукты, как хлеб и рис, как правило, содержат мало лизина. Например, по сравнению с идеальным аминокислотным составом в пшенице мало лизина. Университет Организации Объединенных Наций провел исследование о людях в развивающихся странах, которые зависят от пшеницы как источника белка, и обнаружил недостаток лизина в их рационе. Недостаток лизина и других аминокислот может привести к серьезным проблемам, таким как задержка роста и тяжелые заболевания.

Треонин

Незаменимая аминокислота, которая используется для создания активного центра ферментов.

Фенилаланин

Незаменимая аминокислота, которая используется для производства многих типов полезных аминов.

метионин

Незаменимая аминокислота, которая используется для производства множества различных веществ, необходимых организму.

Гистидин

Незаменимая аминокислота, используемая для производства гистамина.

Триптофан

Незаменимая аминокислота, используемая для производства многих типов полезных аминов.

Незаменимые аминокислоты

Глютамин

Глютамин — одна из самых распространенных аминокислот в организме. Глютамин защищает желудок и желудочно-кишечный тракт. В частности, глутамин используется для выработки энергии в желудочно-кишечном тракте. Глютамин способствует метаболизму алкоголя для защиты печени.

Аспартат

Аспартат — одна из аминокислот, наиболее пригодных для получения энергии. Аспартат — одна из аминокислот, наиболее близко расположенных к циклу трикарбоновой кислоты (ТСА) в организме, который производит энергию.Цикл TCA подобен двигателю, который приводит в движение автомобили. Каждая клетка нашего тела производит энергию.

Глутамат

Бульон комбу, используемый в японской кулинарии, содержит глутамат. Глутамат является основой умами, а свободный глутамат содержится в комбу, помидорах и сыре. Внутри организма глутамат используется как важный источник незаменимых аминокислот.

Аргинин

Аргинин играет важную роль в открытии вен для улучшения кровотока.Оксид азота, открывающий вены, сделан из аргинина. Аргинин — полезная аминокислота для удаления избытка аммиака из организма. Аргинин повышает иммунитет.

Аланин

Аланин поддерживает функцию печени. Аланин используется для производства глюкозы, необходимой организму. Аланин улучшает метаболизм алкоголя.

Proline

Пролин — одна из аминокислот, содержащихся в коллагене, который составляет ткань кожи. Пролин — одна из важнейших аминокислот естественного увлажняющего фактора (NMF), который сохраняет кожу влажной.

Цистеин

Цистеин уменьшает количество производимой черной пигментации меланина. Цистеин много в волосах на голове и теле. Цистеин увеличивает количество желтого меланина, производимого вместо черного меланина.

Аспарагин

Аминокислота, обнаруженная из спаржи. И аспарагин, и аспартат расположены близко к циклу трикарбоновой кислоты (TCA), который производит энергию.

Серин

Аминокислота, используемая для производства фосфолипидов и глицериновой кислоты.

Глицин

Незаменимая аминокислота, вырабатываемая в организме. В организме много глицина. Он действует как передатчик в центральной нервной системе и помогает регулировать такие функции организма, как движение и сенсорное восприятие. Глицин составляет одну треть коллагена.

Тирозин

Тирозин используется для получения многих типов полезных аминов. Тирозин относится к группе ароматических аминокислот вместе с фенилаланином и триптофаном.


Контент, который может вам понравиться

Что такое аминокислоты?

Аминокислоты — незаменимые соединения, общие для всех живых существ, от микробов до людей.Все живые организмы содержат одни и те же 20 видов аминокислот. Что такое …

Факты об аминокислотах

Часто задаваемые вопросы об аминокислотах Общие вопросы об аминокислотах В чем разница между аминокислотой и пептидом? Белки состоят из сотен …

белков | Безграничная биология

Типы и функции белков

Белки выполняют множество важных физиологических функций, в том числе катализируют биохимические реакции.

Цели обучения

Различать типы и функции белков

Основные выводы

Ключевые моменты
  • Белки необходимы для основных физиологических процессов жизни и выполняют функции во всех системах человеческого тела.
  • Форма белка определяет его функцию.
  • Белки состоят из аминокислотных субъединиц, которые образуют полипептидные цепи.
  • Ферменты катализируют биохимические реакции, ускоряя химические реакции, и могут либо разрушать свой субстрат, либо строить более крупные молекулы из субстрата.
  • Форма активного центра фермента соответствует форме субстрата.
  • Гормоны — это тип белков, используемых для передачи сигналов и коммуникации клеток.
Ключевые термины
  • аминокислота : любая из 20 встречающихся в природе α-аминокислот (имеющих амино- и карбоксильные группы на одном атоме углерода) и различных боковых цепей, которые объединяются через пептидные связи с образованием белков.
  • полипептид : любой полимер (одинаковых или разных) аминокислот, соединенных пептидными связями.
  • катализатор : для ускорения процесса.

Типы и функции белков

Белки выполняют важные функции во всех системах человеческого тела. Эти длинные цепи аминокислот критически важны для:

  • катализирующие химические реакции
  • синтез и восстановление ДНК
  • транспортировка материалов по камере
  • прием и отправка химических сигналов
  • отвечает на раздражители
  • обеспечивает структурную опору

Белки (полимеры) представляют собой макромолекулы, состоящие из аминокислотных субъединиц (мономеров).Эти аминокислоты ковалентно связаны друг с другом с образованием длинных линейных цепей, называемых полипептидами, которые затем складываются в определенную трехмерную форму. Иногда эти свернутые полипептидные цепи функционируют сами по себе. В других случаях они объединяются с дополнительными полипептидными цепями, чтобы сформировать окончательную структуру белка. Иногда в конечном белке также требуются неполипептидные группы. Например, гемогобин белка крови состоит из четырех полипептидных цепей, каждая из которых также содержит молекулу гема, имеющую кольцевую структуру с атомом железа в центре.

Белки имеют разную форму и молекулярную массу в зависимости от аминокислотной последовательности. Например, гемоглобин представляет собой глобулярный белок, что означает, что он сворачивается в компактную шарообразную структуру, но коллаген, обнаруженный в нашей коже, представляет собой волокнистый белок, что означает, что он складывается в длинную вытянутую волоконно-подобную цепь. Вы, вероятно, похожи на членов своей семьи, потому что у вас одинаковые белки, но вы отличны от посторонних, потому что белки в ваших глазах, волосах и остальном теле разные.

Гемоглобин человека : Структура гемоглобина человека. Α- и β-субъединицы белков выделены красным и синим цветом, а железосодержащие гемовые группы — зеленым. Из базы данных по белкам.

Поскольку форма определяет функцию, любое незначительное изменение формы белка может привести к нарушению функции белка. Небольшие изменения в аминокислотной последовательности белка могут вызвать разрушительные генетические заболевания, такие как болезнь Хантингтона или серповидно-клеточная анемия.

Ферменты

Ферменты — это белки, которые катализируют биохимические реакции, которые в противном случае не имели бы места.Эти ферменты необходимы для химических процессов, таких как пищеварение и клеточный метаболизм. Без ферментов большинство физиологических процессов протекало бы так медленно (или не протекало бы совсем), что жизнь не могла бы существовать.

Поскольку форма определяет функцию, каждый фермент специфичен для своих субстратов. Субстраты — это реагенты, которые подвергаются химической реакции, катализируемой ферментом. Место, где субстраты связываются с ферментом или взаимодействуют с ним, известно как активный сайт, потому что это место, где происходит химия.Когда субстрат связывается со своим активным центром на ферменте, фермент может способствовать его распаду, перегруппировке или синтезу. Помещая субстрату определенную форму и микроокружение в активном центре, фермент стимулирует протекание химической реакции. Существует два основных класса ферментов:

Ферментная реакция : Катаболическая ферментная реакция, показывающая, что субстрат точно соответствует форме активного центра.

  • Катаболические ферменты: ферменты, расщепляющие субстрат
  • Анаболические ферменты: ферменты, которые создают более сложные молекулы из своих субстратов

Ферменты необходимы для пищеварения: процесс расщепления более крупных молекул пищи на субъединицы, достаточно мелкие, чтобы диффундировать через клеточную мембрану и использоваться клеткой.Эти ферменты включают амилазу, которая катализирует переваривание углеводов во рту и тонком кишечнике; пепсин, катализирующий переваривание белков в желудке; липаза, катализирующая реакции, необходимые для эмульгирования жиров в тонком кишечнике; и трипсин, который катализирует дальнейшее переваривание белков в тонком кишечнике.

Ферменты также необходимы для биосинтеза: процесса создания новых сложных молекул из более мелких субъединиц, которые поставляются или генерируются клеткой.Эти биосинтетические ферменты включают ДНК-полимеразу, которая катализирует синтез новых цепей генетического материала до деления клетки; синтетаза жирных кислот, которая синтезирует новые жирные кислоты для образования жиров или мембранных липидов; и компоненты рибосомы, которая катализирует образование новых полипептидов из мономеров аминокислот.

Гормоны

Некоторые белки действуют как химические сигнальные молекулы, называемые гормонами. Эти белки секретируются эндокринными клетками, которые контролируют или регулируют определенные физиологические процессы, включая рост, развитие, метаболизм и размножение.Например, инсулин — это белковый гормон, который помогает регулировать уровень глюкозы в крови. Другие белки действуют как рецепторы для определения концентрации химических веществ и отправки сигналов для ответа. Некоторые типы гормонов, такие как эстроген и тестостерон, являются липидными стероидами, а не белками.

Другие функции белков

Белки выполняют важные функции во всех системах человеческого тела. В дыхательной системе гемоглобин (состоящий из четырех белковых субъединиц) транспортирует кислород для использования в клеточном метаболизме.Дополнительные белки в плазме крови и лимфе переносят питательные вещества и продукты метаболизма по всему телу. Белки актин и тубулин образуют клеточные структуры, а кератин формирует структурную опору для мертвых клеток, которые становятся ногтями и волосами. Антитела, также называемые иммуноглобинами, помогают распознавать и уничтожать чужеродные патогены в иммунной системе. Актин и миозин позволяют мышцам сокращаться, а альбумин питает раннее развитие эмбриона или проростка.

Тубулин : структурный белок тубулин, окрашенный в красный цвет в клетках мыши.

Аминокислоты

Аминокислота содержит аминогруппу, карбоксильную группу и группу R и объединяется с другими аминокислотами с образованием полипептидных цепей.

Цели обучения

Опишите структуру аминокислоты и особенности, которые придают ее специфическим свойствам

Основные выводы

Ключевые моменты
  • Каждая аминокислота содержит центральный атом C, аминогруппу (Nh3), карбоксильную группу (COOH) и определенную группу R.
  • Группа R определяет характеристики (размер, полярность и pH) для каждого типа аминокислоты.
  • Пептидные связи образуются между карбоксильной группой одной аминокислоты и аминогруппой другой путем дегидратационного синтеза.
  • Цепь аминокислот представляет собой полипептид.
Ключевые термины
  • аминокислота : любая из 20 встречающихся в природе α-аминокислот (имеющих амино- и карбоксильные группы на одном атоме углерода) и различных боковых цепей, которые объединяются через пептидные связи с образованием белков.
  • Группа R : Группа R представляет собой боковую цепь, специфичную для каждой аминокислоты, которая придает определенные химические свойства этой аминокислоте.
  • полипептид : любой полимер (одинаковых или разных) аминокислот, соединенных пептидными связями.

Структура аминокислоты

Аминокислоты — это мономеры, из которых состоят белки. Каждая аминокислота имеет одинаковую фундаментальную структуру, которая состоит из центрального атома углерода, также известного как альфа (α) углерод, связанного с аминогруппой (NH 2 ), карбоксильной группой (COOH) и водородом. атом.В водной среде клетки как аминогруппа, так и карбоксильная группа ионизируются в физиологических условиях, и поэтому имеют структуры -NH 3 + и -COO соответственно. Каждая аминокислота также имеет другой атом или группу атомов, связанных с центральным атомом, известную как группа R. Эта группа R или боковая цепь придает каждой аминокислоте специфические характеристики белков, включая размер, полярность и pH.

Аминокислотная структура : Аминокислоты имеют центральный асимметричный атом углерода, к которому присоединены аминогруппа, карбоксильная группа, атом водорода и боковая цепь (группа R).Эта аминокислота неионизирована, но если ее поместить в воду с pH 7, ее аминогруппа получит другой водород и положительный заряд, а гидроксил в своей карбоксильной группе потеряет водород и получит отрицательный заряд.

Типы аминокислот

Название «аминокислота» происходит от аминогруппы и карбоксикислотной группы в их основной структуре. В белках присутствует 21 аминокислота, каждая из которых имеет определенную группу R или боковую цепь. Десять из них считаются незаменимыми аминокислотами для человека, потому что человеческий организм не может их производить, и они должны быть получены с пищей.Все организмы имеют разные незаменимые аминокислоты в зависимости от их физиологии.

Типы аминокислот : В белках обычно встречается 21 обычная аминокислота, каждая из которых имеет свою R-группу (вариантную группу), которая определяет ее химическую природу. 21-я аминокислота, не показанная здесь, представляет собой селеноцистеин с группой R -CH 2 -SeH.

Характеристики аминокислот

Какие категории аминокислот вы ожидаете найти на поверхности растворимого белка, а какие — внутри? Какое распределение аминокислот вы ожидаете найти в белке, встроенном в липидный бислой?

Химический состав боковой цепи определяет характеристики аминокислоты.Аминокислоты, такие как валин, метионин и аланин, неполярны (гидрофобны), тогда как аминокислоты, такие как серин, треонин и цистеин, полярны (гидрофильны). Боковые цепи лизина и аргинина заряжены положительно, поэтому эти аминокислоты также известны как основные (с высоким pH) аминокислоты. Пролин является исключением из стандартной структуры аминокислоты, поскольку его группа R связана с аминогруппой, образуя кольцеобразную структуру.

Аминокислоты обозначаются одной заглавной буквой или трехбуквенным сокращением.Например, валин обозначается буквой V или трехбуквенным символом val.

Пептидные облигации

Последовательность и количество аминокислот в конечном итоге определяют форму, размер и функцию белка. Каждая аминокислота связана с другой аминокислотой ковалентной связью, известной как пептидная связь. Когда две аминокислоты ковалентно связаны пептидной связью, карбоксильная группа одной аминокислоты и аминогруппа входящей аминокислоты объединяются и высвобождают молекулу воды.Любая реакция, которая объединяет два мономера в реакцию, которая генерирует H 2 O в качестве одного из продуктов, известна как реакция дегидратации, поэтому образование пептидной связи является примером реакции дегидратации.

Образование пептидной связи : Образование пептидной связи представляет собой реакцию синтеза дегидратации. Карбоксильная группа одной аминокислоты связана с аминогруппой входящей аминокислоты. При этом выделяется молекула воды.

Полипептидные цепи

Образовавшаяся цепочка аминокислот называется полипептидной цепью.Каждый полипептид имеет свободную аминогруппу на одном конце. Этот конец называется N-концом или амино-концом, а другой конец имеет свободную карбоксильную группу, также известную как C или карбоксильный конец. При считывании или сообщении аминокислотной последовательности белка или полипептида принято использовать направление от N к C. То есть предполагается, что первая аминокислота в последовательности находится на N-конце, а последняя аминокислота — на C-конце.

Хотя термины полипептид и белок иногда используются взаимозаменяемо, полипептид технически представляет собой любой полимер аминокислот, тогда как термин белок используется для полипептида или полипептидов, которые сложены должным образом, в сочетании с любыми дополнительными компонентами, необходимыми для правильного функционирования, и являются теперь работоспособен.

Структура белка

Каждый последующий уровень сворачивания белка в конечном итоге влияет на его форму и, следовательно, на его функцию.

Цели обучения

Обобщите четыре уровня структуры белка

Основные выводы

Ключевые моменты
  • Структура белка зависит от его аминокислотной последовательности и локальных низкоэнергетических химических связей между атомами как в основной цепи полипептида, так и в боковых цепях аминокислот.
  • Структура белка играет ключевую роль в его функции; если белок теряет свою форму на каком-либо структурном уровне, он может больше не функционировать.
  • Первичная структура — это аминокислотная последовательность.
  • Вторичная структура представляет собой локальные взаимодействия между участками полипептидной цепи и включает структуры α-спирали и β-складчатых листов.
  • Третичная структура — это общая трехмерная складчатость, в значительной степени обусловленная взаимодействиями между R-группами.
  • Четвертичные структуры — это ориентация и расположение субъединиц в мульти-субъединичном белке.
Ключевые термины
  • антипараллельный : Природа противоположных ориентаций двух цепей ДНК или двух бета-цепей, составляющих вторичную структуру белка
  • дисульфидная связь : Связь, состоящая из ковалентной связи между двумя атомами серы, образованная реакцией двух тиоловых групп, особенно между тиоловыми группами двух белков
  • β-складчатый лист : вторичная структура белков, где группы N-H в основной цепи одной полностью вытянутой цепи устанавливают водородные связи с группами C = O в основной цепи соседней полностью вытянутой цепи
  • α-спираль : вторичная структура белков, где каждый N-H основной цепи создает водородную связь с группой C = O аминокислоты на четыре остатка ранее в той же спирали.

Форма белка имеет решающее значение для его функции, поскольку она определяет, может ли белок взаимодействовать с другими молекулами. Белковые структуры очень сложны, и только совсем недавно исследователи смогли легко и быстро определить структуру полных белков вплоть до атомного уровня. (Используемые методы восходят к 1950-м годам, но до недавнего времени они были очень медленными и трудоемкими в использовании, поэтому полные белковые структуры решались очень медленно.) Ранние структурные биохимики концептуально разделили белковые структуры на четыре «уровня», чтобы упростить задачу. чтобы разобраться в сложности общей структуры.Чтобы определить, как белок приобретает свою окончательную форму или конформацию, нам необходимо понять эти четыре уровня структуры белка: первичный, вторичный, третичный и четвертичный.

Первичная структура

Первичная структура белка — это уникальная последовательность аминокислот в каждой полипептидной цепи, из которой состоит белок. На самом деле, это просто список аминокислот в полипептидной цепи, а не ее структура. Но поскольку окончательная структура белка в конечном итоге зависит от этой последовательности, это было названо первичной структурой полипептидной цепи.Например, гормон поджелудочной железы инсулин имеет две полипептидные цепи, A и B.

Первичная структура : Цепь А инсулина имеет длину 21 аминокислоту, а цепь В — 30 аминокислот, и каждая последовательность уникальна для белка инсулина.

Ген или последовательность ДНК в конечном итоге определяет уникальную последовательность аминокислот в каждой пептидной цепи. Изменение нуклеотидной последовательности кодирующей области гена может привести к добавлению другой аминокислоты к растущей полипептидной цепи, вызывая изменение структуры белка и, следовательно, функции.

Гемоглобин, транспортирующий кислород, состоит из четырех полипептидных цепей, двух идентичных α-цепей и двух идентичных β-цепей. При серповидно-клеточной анемии простая замена аминогруппы в β-цепи гемоглобина вызывает изменение структуры всего белка. Когда аминокислота глутаминовая кислота заменяется валином в β-цепи, полипептид складывается в несколько иную форму, что создает дисфункциональный белок гемоглобина. Итак, всего одна замена аминокислоты может вызвать кардинальные изменения.Эти дисфункциональные белки гемоглобина в условиях низкого содержания кислорода начинают связываться друг с другом, образуя длинные волокна, состоящие из миллионов агрегированных гемоглобинов, которые искажают эритроциты в форме полумесяца или «серпа», которые закупоривают артерии. Люди, страдающие этим заболеванием, часто испытывают одышку, головокружение, головные боли и боли в животе.

Серповидно-клеточная анемия : серповидные клетки имеют форму полумесяца, тогда как нормальные клетки имеют форму диска.

Вторичная структура

Вторичная структура белка — это любые регулярные структуры, возникающие в результате взаимодействий между соседними или соседними аминокислотами, когда полипептид начинает складываться в свою функциональную трехмерную форму.Вторичные структуры возникают, когда образуются Н-связи между локальными группами аминокислот в области полипептидной цепи. Редко единичная вторичная структура распространяется по всей полипептидной цепи. Обычно это просто часть цепочки. Наиболее распространенными формами вторичной структуры являются α-спиральные и β-складчатые листовые структуры, и они играют важную структурную роль в большинстве глобулярных и волокнистых белков.

Вторичная структура : α-спираль и β-складчатый лист образуются из-за водородной связи между карбонильной и аминогруппой в основной цепи пептида.Некоторые аминокислоты имеют склонность к образованию α-спирали, а другие — к образованию β-складчатого листа.

В цепи α-спирали водородная связь образуется между атомом кислорода в карбонильной группе основной цепи полипептида в одной аминокислоте и атомом водорода в аминогруппе основной цепи полипептида другой аминокислоты, которая находится на четыре аминокислоты дальше по цепи. Это удерживает отрезок аминокислот в правой спирали. Каждый виток в альфа-спирали имеет 3.6 аминокислотных остатков. Группы R (боковые цепи) полипептида выступают из цепи α-спирали и не участвуют в Н-связях, которые поддерживают структуру α-спирали.

В β-гофрированных листах участки аминокислот сохраняются в почти полностью вытянутой конформации, которая «складывается» или зигзагообразно из-за нелинейной природы одиночных ковалентных связей C-C и C-N. β-гофрированные листы никогда не встречаются в одиночку. Они должны удерживаться на месте другими β-гофрированными листами. Участки аминокислот в β-складчатых листах удерживаются в их складчатой ​​структуре листа, потому что водородные связи образуются между атомом кислорода в карбонильной группе полипептидной основной цепи одного β-складчатого листа и атомом водорода в аминогруппе полипептидного каркаса другого β-складчатого листа. лист гофрированный.Скрепляющие друг друга β-гофрированные листы выровнены параллельно или антипараллельно друг другу. Группы R аминокислот в β-складчатом листе указывают перпендикулярно водородным связям, удерживающим β-складчатые листы вместе, и не участвуют в поддержании структуры β-складчатого листа.

Третичная структура

Третичная структура полипептидной цепи — это ее общая трехмерная форма после того, как все элементы вторичной структуры сложены вместе друг с другом.Взаимодействия между полярной, неполярной, кислотной и основной R-группой в полипептидной цепи создают сложную трехмерную третичную структуру белка. Когда сворачивание белка происходит в водной среде тела, гидрофобные группы R неполярных аминокислот в основном лежат внутри белка, в то время как гидрофильные группы R лежат в основном снаружи. Боковые цепи цистеина образуют дисульфидные связи в присутствии кислорода, единственную ковалентную связь, образующуюся во время сворачивания белка.Все эти взаимодействия, слабые и сильные, определяют окончательную трехмерную форму белка. Когда белок теряет свою трехмерную форму, он больше не функционирует.

Третичная структура : Третичная структура белков определяется гидрофобными взаимодействиями, ионными связями, водородными связями и дисульфидными связями.

Четвертичная структура

Четвертичная структура белка — это то, как его субъединицы ориентированы и расположены относительно друг друга.В результате четвертичная структура применима только к многосубъединичным белкам; то есть белки, состоящие из более чем одной полипептидной цепи. Белки, полученные из одного полипептида, не будут иметь четвертичной структуры.

В белках с более чем одной субъединицей слабые взаимодействия между субъединицами помогают стабилизировать общую структуру. Ферменты часто играют ключевую роль в связывании субъединиц с образованием конечного функционирующего белка.

Например, инсулин представляет собой шарообразный глобулярный белок, который содержит как водородные связи, так и дисульфидные связи, которые удерживают вместе две его полипептидные цепи.Шелк — это волокнистый белок, который образуется в результате водородных связей между различными β-складчатыми цепями.

Четыре уровня структуры белка : На этих иллюстрациях можно увидеть четыре уровня структуры белка.

Денатурация и сворачивание белков

Денатурация — это процесс, при котором белки теряют свою форму и, следовательно, свою функцию из-за изменений pH или температуры.

Цели обучения

Обсудить процесс денатурации белка

Основные выводы

Ключевые моменты
  • Белки меняют свою форму под воздействием различных значений pH или температуры.
  • Организм строго регулирует pH и температуру, чтобы предотвратить денатурацию белков, таких как ферменты.
  • Некоторые белки могут восстанавливаться после денатурации, а другие — нет.
  • Белки-шапероны помогают некоторым белкам принимать правильную форму.
Ключевые термины
  • шаперонин : белки, которые обеспечивают благоприятные условия для правильного сворачивания других белков, тем самым предотвращая агрегацию
  • денатурация : изменение складчатой ​​структуры белка (и, следовательно, физических свойств), вызванное нагреванием, изменением pH или воздействием определенных химических веществ

Каждый белок имеет свою уникальную последовательность аминокислот, и взаимодействия между этими аминокислотами создают определенную форму.Эта форма определяет функцию белка, от переваривания белка в желудке до переноса кислорода в кровь.

Изменение формы белка

Если белок подвержен изменениям температуры, pH или воздействию химикатов, внутренние взаимодействия между аминокислотами белка могут измениться, что, в свою очередь, может изменить форму белка. Хотя аминокислотная последовательность (также известная как первичная структура белка) не изменяется, форма белка может измениться настолько, что станет дисфункциональной, и в этом случае белок считается денатурированным.Пепсин, фермент, расщепляющий белок в желудке, действует только при очень низком pH. При более высоких значениях pH конформация пепсина, способ сворачивания его полипептидной цепи в трех измерениях, начинает меняться. В желудке поддерживается очень низкий уровень pH, чтобы пепсин продолжал переваривать белок и не денатурировал его.

Ферменты

Поскольку почти все биохимические реакции требуют ферментов, и поскольку почти все ферменты оптимально работают только в относительно узких диапазонах температуры и pH, многие гомеостатические механизмы регулируют соответствующие температуры и pH, чтобы ферменты могли поддерживать форму своего активного центра.

Реверс денатурации

Часто можно обратить денатурацию, потому что первичная структура полипептида, ковалентные связи, удерживающие аминокислоты в их правильной последовательности, не повреждены. После удаления денатурирующего агента первоначальные взаимодействия между аминокислотами возвращают белок к его исходной конформации, и он может возобновить свою функцию.

Однако денатурация может быть необратимой в экстремальных ситуациях, например, при жарке яйца. Тепло от сковороды денатурирует белок альбумина в жидком яичном белке, и он становится нерастворимым.Белок в мясе также денатурирует и становится твердым при приготовлении.

Денатурация белка иногда необратима. : (Вверху) Белковый альбумин в сыром и вареном яичном белке. (Внизу) Аналогия со скрепкой визуализирует процесс: когда скрепки сшиваются, скрепки («аминокислоты») больше не перемещаются свободно; их структура перестраивается и «денатурируется».

Белки-шапероны (или шаперонины) являются белками-помощниками, которые обеспечивают благоприятные условия для сворачивания белков.Шаперонины скапливаются вокруг формирующегося белка и предотвращают агрегацию других полипептидных цепей. Как только целевой белок сворачивается, шаперонины диссоциируют.

аминокислот | Биология для майоров I

Результаты обучения

  • Продемонстрировать знакомство с мономерными единицами белков: аминокислоты

Белки являются одними из наиболее распространенных органических молекул в живых системах и обладают самым разнообразным набором функций среди всех макромолекул.Белки могут быть структурными, регуляторными, сократительными или защитными; они могут служить для транспортировки, хранения или перепонки; или они могут быть токсинами или ферментами. Каждая клетка живой системы может содержать тысячи белков, каждый из которых выполняет уникальную функцию. Их структуры, как и их функции, сильно различаются. Однако все они представляют собой полимеры из аминокислот , расположенных в линейной последовательности.

Рис. 1. Аминокислоты имеют центральный асимметричный углерод, к которому присоединены аминогруппа, карбоксильная группа, атом водорода и боковая цепь (R-группа).

Аминокислоты — это мономеры, из которых состоят белки. Каждая аминокислота имеет одинаковую фундаментальную структуру, которая состоит из центрального атома углерода, также известного как альфа ( α ) углерода, связанного с аминогруппой (Nh3), карбоксильной группой (COOH) и атомом водорода. . Каждая аминокислота также имеет другой атом или группу атомов, связанных с центральным атомом, известную как группа R (рис. 1).

Название «аминокислоты» происходит от того факта, что они содержат как аминогруппу, так и карбоксильно-кислотную группу в своей основной структуре.Как уже упоминалось, в белках присутствует 20 аминокислот. Девять из них считаются незаменимыми аминокислотами у людей, потому что человеческий организм не может их производить, и они получают их с пищей.

Для каждой аминокислоты группа R (или боковая цепь) отличается (рис. 2).

Практический вопрос

Рис. 2. В белках обычно встречаются 20 общих аминокислот, каждая из которых имеет свою R-группу (вариантная группа), которая определяет его химическую природу.

Какие категории аминокислот вы ожидаете найти на поверхности растворимого белка, а какие — внутри? Какое распределение аминокислот вы ожидаете найти в белке, встроенном в липидный бислой?

Показать ответ

Полярные и заряженные аминокислотные остатки (остаток после образования пептидной связи) с большей вероятностью будут обнаружены на поверхности растворимых белков, где они могут взаимодействовать с водой, и неполярные (например.g., боковые цепи аминокислот) с большей вероятностью будут обнаружены внутри, где они изолированы от воды. В мембранных белках неполярные и гидрофобные боковые цепи аминокислот связаны с гидрофобными хвостами фосфолипидов, в то время как полярные и заряженные боковые цепи аминокислот взаимодействуют с полярными головными группами или с водным раствором. Однако бывают исключения. Иногда положительно и отрицательно заряженные боковые цепи аминокислот взаимодействуют друг с другом внутри белка, а полярные или заряженные боковые цепи аминокислот, которые взаимодействуют с лигандом, могут быть обнаружены в кармане связывания лиганда.

Химическая природа боковой цепи определяет природу аминокислоты (то есть, является ли она кислотной, основной, полярной или неполярной). Например, аминокислота глицин имеет атом водорода в качестве группы R. Аминокислоты, такие как валин, метионин и аланин, неполярны или гидрофобны по природе, тогда как аминокислоты, такие как серин, треонин и цистеин, полярны и имеют гидрофильные боковые цепи. Боковые цепи лизина и аргинина заряжены положительно, поэтому эти аминокислоты также известны как основные аминокислоты.Пролин имеет группу R, которая связана с аминогруппой, образуя кольцеобразную структуру. Пролин является исключением из стандартной структуры аминокислоты, поскольку его аминогруппа не отделена от боковой цепи (рис. 2).

Аминокислоты обозначаются одной заглавной буквой или трехбуквенным сокращением. Например, валин обозначается буквой V или трехбуквенным символом val. Так же, как некоторые жирные кислоты необходимы для диеты, некоторые аминокислоты также необходимы. Они известны как незаменимые аминокислоты, а у людей они включают изолейцин, лейцин и цистеин.Незаменимые аминокислоты относятся к тем, которые необходимы для построения белков в организме, но не производятся организмом; Какие аминокислоты являются незаменимыми, варьируется от организма к организму.

Рис. 3. Образование пептидной связи — это реакция синтеза дегидратации. Карбоксильная группа одной аминокислоты связана с аминогруппой входящей аминокислоты. При этом выделяется молекула воды.

Последовательность и количество аминокислот в конечном итоге определяют форму, размер и функцию белка.Каждая аминокислота присоединена к другой аминокислоте ковалентной связью, известной как пептидная связь, которая образуется в результате реакции дегидратации. Карбоксильная группа одной аминокислоты и аминогруппа входящей аминокислоты объединяются, высвобождая молекулу воды. Полученная связь представляет собой пептидную связь (рис. 3).

Продукты, образованные такими связями, называются пептидами. По мере того, как к этой растущей цепи присоединяется больше аминокислот, полученная цепь называется полипептидом. Каждый полипептид имеет свободную аминогруппу на одном конце.Этот конец называется N-концом или амино-концом, а другой конец имеет свободную карбоксильную группу, также известную как C или карбоксильный конец. Хотя термины полипептид и белок иногда используются взаимозаменяемо, полипептид технически представляет собой полимер аминокислот, тогда как термин белок используется для полипептида или полипептидов, которые объединились вместе, часто имеют связанные непептидные простетические группы, имеют различную форму. , и имеют уникальную функцию. После синтеза (трансляции) белков большинство белков модифицируются.Они известны как посттрансляционные модификации. Они могут подвергаться расщеплению, фосфорилированию или могут потребовать добавления других химических групп. Только после этих модификаций белок становится полностью функциональным.

Эволюционное значение цитохрома c

Цитохром c является важным компонентом цепи переноса электронов, частью клеточного дыхания, и обычно он находится в клеточной органелле, митохондрии. Этот белок имеет простетическую группу гема, и центральный ион гема попеременно восстанавливается и окисляется во время переноса электрона.Поскольку роль этого важного белка в производстве клеточной энергии имеет решающее значение, за миллионы лет он очень мало изменился. Секвенирование белков показало, что существует значительная гомология аминокислотной последовательности цитохрома с среди различных видов; другими словами, эволюционное родство можно оценить путем измерения сходства или различий между последовательностями ДНК или белков различных видов.

Ученые определили, что цитохром с человека содержит 104 аминокислоты.Для каждой молекулы цитохрома с из разных организмов, которая была секвенирована на сегодняшний день, 37 из этих аминокислот появляются в одном и том же положении во всех образцах цитохрома с. Это указывает на то, что, возможно, был общий предок. При сравнении последовательностей белков человека и шимпанзе различий в последовательностях не обнаружено. Когда сравнивали последовательности человека и макаки-резуса, единственное обнаруженное различие заключалось в одной аминокислоте. В другом сравнении секвенирование человека и дрожжей показывает разницу в 44-м положении.

Внесите свой вклад!

У вас была идея улучшить этот контент? Нам очень понравится ваш вклад.

Улучшить эту страницуПодробнее

аминокислот | Спросите у биолога

Белковые части


Белки — это не то же самое, что строительные блоки Lego, но белки имеют особую форму, которую можно использовать для построения частей тела. Портрет Джонсона Ригейры Lego через Викимедиа. Щелкните изображение, чтобы увидеть его в полном размере.

Так же, как домик Lego сделан из кирпичей, белки состоят из множества крошечных строительных блоков.Эти строительные блоки называются аминокислотами.

Чтобы построить белок, сначала аминокислоты соединяются в длинные цепи. Эти цепочки аминокислотных строительных блоков затем могут складываться в любые формы. Некоторые цепочки складываются в спирали. Другие цепочки делают зигзагообразные листы и петли.

Объединение этих спиралей, листов и петель — вот как создается трехмерная форма белка. Вы также можете комбинировать несколько цепочек аминокислот, чтобы получить еще более крупные формы белка.

21 — это все, что нужно

Человеческое тело использует всего 21 аминокислоту для производства всех белков, необходимых для функционирования и роста.Поскольку аминокислоты могут быть расположены во многих различных комбинациях, ваше тело может производить тысячи различных видов белков из одной и той же 21 аминокислоты. Вы можете увидеть книги, в которых говорится, что аминокислот всего 20. Не волнуйтесь, это только потому, что 21-й был обнаружен совсем недавно, и еще не все книги дошли до него.

21 аминокислота. Нажмите на изображение, чтобы увидеть его в увеличенном виде.

Незаменимые аминокислоты

Есть девять аминокислот, которые ваше тело не может вырабатывать.Их называют незаменимыми аминокислотами, то есть они необходимы для жизни. Они содержатся в таких продуктах, как молоко, яйца и мясо, а также в самых разных растениях. Это одна из причин, почему вы не можете долго жить на диете, состоящей только из кукурузных чипсов. Незаменимые аминокислоты были фактически обнаружены в ходе эксперимента по тестированию чего-то очень похожего на «диету с кукурузными чипсами».

Ученые кормили крыс диетой, в которой был только кукурузный белок, и наблюдали за результатами. Они заметили, что крысы, соблюдающие эту диету, заболевают и в конечном итоге умирают.Однако когда больным крысам давали белок из молока, им становилось лучше. Это показало ученым, что что-то в молочном белке необходимо для здоровья крыс, что они не могут жить без него.

Откуда берутся аминокислоты?

К продуктам с высоким содержанием белка относятся мясо, рыба, яйца, орехи, шпинат, спаржа, бобы и брюссельская капуста.

Точно так же, как домик Lego, построенный из кубиков Lego, можно разобрать, а из кубиков построить что-то совершенно другое (например, действительно крутого тираннозавра), ваше тело может разобрать на части строительные блоки аминокислот, из которых состоит белок и повторно использовать их для создания новых, совершенно других белков.Даже ваше тело знает, что переработка — это действительно круто!

Но откуда берутся эти аминокислотные строительные блоки? Оказывается, ваши клетки могут производить большую часть необходимых им аминокислот из других молекул вашего тела. Однако девять из этих аминокислот он не может производить, поэтому вы должны получать их из пищи, которую вы едите. В противном случае это было бы похоже на то, что в наборе Лего не хватает девяти видов кирпичей, чтобы быть полным набором. Есть определенные вещи, которые невозможно построить без недостающих строительных блоков.

Аминокислоты — обзор

Электролитные и кислотно-основные свойства

Аминокислоты — это амфолиты; я.е., они содержат как кислотные, так и основные группы. Свободные аминокислоты никогда не могут встречаться в виде неионных молекул. Вместо этого они существуют как нейтральные цвиттер-ионы , которые содержат как положительно, так и отрицательно заряженные группы. Цвиттерионы электрически нейтральны и поэтому не мигрируют в электрическом поле. В кислом растворе (ниже pH 2,0) преобладающая разновидность аминокислоты заряжена положительно и мигрирует к катоду. В щелочном растворе (pH выше 9,7) преобладающая разновидность аминокислоты заряжена отрицательно и мигрирует к аноду.

Изоэлектрическая точка (pI) аминокислоты — это pH, при котором молекула имеет нулевой средний суммарный заряд и, следовательно, не перемещается в электрическом поле. PI рассчитывается путем усреднения значений pK ‘для двух функциональных групп, которые вступают в реакцию, когда цвиттерион попеременно становится одновалентным катионом или одновалентным анионом.

При физиологическом pH моноаминомонокарбоновые аминокислоты, например, глицин и аланин, существуют в виде цвиттерионов. То есть при pH 6.9–7.4, α-карбоксильная группа (pK ‘= 2,4) диссоциирует с образованием отрицательно заряженного карбоксилатного иона (COO ), в то время как α-аминогруппа (pK ′ =. 7) протонируется с образованием аммония. группа (NH 3 + ). Значение pK ‘α-карбоксильной группы значительно ниже, чем у сопоставимой алифатической кислоты, например, уксусной кислоты (pK’ = 4,6). Эта более сильная кислотность обусловлена ​​захватом электронов положительно заряженным ионом аммония и, как следствие, повышенной склонностью карбоксильного водорода к диссоциации в виде H + .Группа α-аммония, соответственно, является более слабой кислотой, чем алифатический ион аммония, например, этиламин (pK ‘= 9,0), поскольку индуктивный эффект отрицательно заряженного карбоксилат-аниона имеет тенденцию предотвращать диссоциацию H + . Профиль титрования глицина (рис. 3.6) почти идентичен профилям всех других моноаминомонокарбоновых аминокислот с неионизируемыми R-группами (Ala, Val, Leu, Ile, Phe, Ser, Thr, Gln, Asn, Met и Pro). .

Рисунок 3.6. Профиль титрования глицина, моноаминомонокарбоновой кислоты.

Титрование глицина имеет следующие основные особенности. Титрование инициируют гидрохлоридом глицина, Cl (H 3 + NCH 2 COOH), который является полностью протонированной формой аминокислоты. В этой форме молекула содержит две кислотные функциональные группы; следовательно, для полного титрования 1 моля гидрохлорида глицина требуется два эквивалента основания. Имеются два значения pK ‘: pK’1 из-за реакции карбоксильной группы и pK’2 из-за реакции аммониевой группы.Добавление 0,5 экв. Основания к 1 моль гидрохлорида глицина повышает pH 2,34 (pK’1), тогда как добавление 1,5 экв. Дополнительно увеличивает pH до 9,66 (pK’2). При низких значениях pH (например, 0,4) молекулы представляют собой преимущественно катионы с одним положительным зарядом; при значениях pH 5–7 у большинства молекул чистый заряд равен нулю; при высоких значениях pH (например, 11,7) все молекулы по существу являются анионами с одним отрицательным зарядом. Середина между двумя значениями pK ‘[т.е. при pH = (2,34 + 9,66) / 2= 6,0] — это pI. Таким образом, pI — это среднее арифметическое значений pK′1 и pK′2 и точка перегиба между двумя сегментами профиля титрования.

Буферная способность слабых кислот и слабых оснований максимальна при их значениях pK ‘. Таким образом, моноаминомонокарбоновые кислоты проявляют наибольшую буферную способность в двух диапазонах pH, близких к двум их значениям pK ‘, а именно, pH 2,3 и pH 9,7 (рис. 3.6). Ни эти аминокислоты, ни α-амино- или α-карбоксильные группы других аминокислот (которые имеют аналогичные значения pK ‘) не обладают значительной буферной способностью в нейтральном (физиологическом) диапазоне pH. Единственными аминокислотами с R-группами, которые обладают буферной способностью в физиологическом диапазоне pH, являются гистидин (имидазол; pK ‘= 6.0) и цистеин (сульфгидрил; pK ‘= 8,3). Значения pK и pI для выбранных аминокислот перечислены в таблице 3.2. Значения pK ‘для R-групп меняются в зависимости от ионного окружения.

Таблица 3.2. Значения pK ‘и pI выбранных свободных аминокислот при 25 ° C *

Аминокислота pK’1 (α-COOH) pK’2 pK’3 pI
Аланин 2,34 9,69 (β-Nh4 +) 6,00
Аспарагиновая кислота 2.09 3,86 (γ-COOH) 9,82 (α-Nh4 +) 2,98 (pK’1 + pK’22)
Глутаминовая кислота 2,19 4,25 (γ-COOH) 9,67 ( α-Nh4 +) 3,22 (pK’1 + pK’22)
Аргинин 2,17 9,04 (α-Nh4 +) 12,48 (Гуанидин) 10,76 (pK’2 + pK’32)
Гистидин 1,82 6,00 (имидазолий) 9,17 (Nh4 +) 7,59 (pK’2 + pK’32)
Лизин 2.18 8,95 (α-Nh4 +) 10,53 (ε-Nh4 +) 9,74 (pK’2 + pK’32)
Цистеин 1,71 8,33 (SH) 10,78 (α-Nh4 + ) 5,02 (pK’1 + pK’22)
Тирозин 2,20 9,11 (α-Nh4 +) 10,07 (фенол OH) 5,66 (pK’1 + pK’22)
Серин 2,21 9,15 (α-Nh4 +) 13,6 (Спирт ОН) 5,68 (pK’1 + pK’22)

Значения pK ‘для функциональных групп белков могут значительно различаться от значений свободных аминокислот.R-группы ионизируются при физиологическом pH и имеют анионные и катионные группы соответственно.

Строительные блоки белка в организме

Есть два типа аминокислот: незаменимые и заменимые. Человеческое тело не производит эти белки, хотя они жизненно важны для поддержания жизни человека. Это означает, что вы должны получать их с белками, содержащимися в растительной и животной пище.

Восемь незаменимых аминокислот:

  • Изолейцин
  • Лейцин
  • Лизин
  • Метионин
  • Фенилаланин
  • Треонин
  • Триптофан
  • Валин

Кроме этих восьми, существует гистидина .Технически он принадлежит к списку незаменимых аминокислот. Однако детский организм не вырабатывает достаточное количество гистидина и, следовательно, должен получать добавки с пищей.

Продукты, богатые изолейцином

Молоко и молочные продукты
Яйца
Курица
Говядина
Свинина
Орехи и семена
Бобовые, горох, фасоль и арахисовое масло

Продукты, богатые лейцином

Сыр пармезан
Соевые бобы
Куриная грудка
Тунец
Говядина
Орехи
Соевые бобы

Продукты, богатые лизином

Постная говядина
Свинина
Сыр пармезан
Индейка и курица
Тунец, приготовленный
Яйца
Белая фасоль

Продукты, богатые метионином

Рыба и моллюски
Сыр Пармезан
Белая фасоль
Яйца
Индейка и курица
Постная говядина
Баранина

Продукты, богатые фенилаланином

Сыр пармезан
Молочные продукты
Постная говядина и баранина
Яйца
Бобы пинто
Соевые бобы
Белые бобы

Продукты, богатые треонином

Индейка и курица
Сыр пармезан
Постная говядина и баранина
Рыба и моллюски
Орехи
Белая фасоль
Соевые бобы

Продукты, богатые триптофаном

Семена и орехи
Ягненок
Курица и индейка
Рыба и крабы
Фасоль
Говядина
Соевые бобы

Продукты, богатые валином

Молочные продукты, сыр и яйца
Семена и орехи
Рыба
Свинина
Говядина
Фасоль
Курица и индейка

Продукты, богатые гистидином

Рыба
Свинина
Фасоль
Яйца и молочные продукты
Семена и орехи
Индейка и курица
Соевые бобы

Не все эти источники одинаковы.Некоторые содержат большее количество белка с более высокой биологической ценностью, особенно белки животных. Конечно, это не означает, что вы не можете получить необходимые белки и аминокислоты из вегетарианской диеты. Это означает, что вам нужно комбинировать разные источники, которые дополняют друг друга. Например, фасоль и тосты дополняют друг друга, помогая вашему организму более эффективно усваивать белки, содержащиеся в фасоли.

Глава 3. Белки и аминокислоты

Глава 3. Белки и аминокислоты



1.БЕЛКИ
2. ПИЩЕВАРЕНИЕ БЕЛКОВ И МЕТАБОЛИЗМ
3. ОБЩИЕ ТРЕБОВАНИЯ К БЕЛКАМ
4. АМИНОКИСЛОТЫ
5. КОЛИЧЕСТВО ТРЕБОВАНИЯ К АМИНОКИСЛОТЕ
6. ДОБАВКА ДИЕТЫ С АМИНОКИСЛОТАМИ
7. ССЫЛКИ


J. E. Halver
Вашингтонский университет
Сиэтл, Вашингтон

1.1 Классификация
1.2 Структура
1.3 Свойства
1.4 Химическое определение


Белки представляют собой сложные органические соединения, состоящие из множества аминокислот, связанных вместе пептидными связями и поперечно связанных цепей сульфгидрильными связями, водородными связями и силами Ван-дер-Ваальса.Химический состав белков больше, чем у любой другой группы биологически активных соединений. Белки в различных клетках животных и растений придают этим тканям их биологическую специфичность.

1.1 Классификация

Белки можно разделить на:

(а) Простые белки. При гидролизе они дают только аминокислоты и иногда небольшие углеводные соединения. Примеры: альбумины, глобулины, глютелины, альбуминоиды, гистоны и протамины.

(б) Конъюгированные белки. Это простые белки в сочетании с некоторыми небелковыми веществами в организме. Примеры: нуклеопротеины, гликопротеины, фосфопротеины, гемоглобины и лецитопротеины.

(c) Производные белки. Это белки, полученные из простых или конъюгированных белков физическими или химическими способами. Примеры: денатурированные белки и пептиды.

1,2 Конструкция

Потенциальная конфигурация белковых молекул настолько сложна, что многие типы белковых молекул могут быть сконструированы и обнаружены в биологических материалах с различными физическими характеристиками.Глобулярные белки обнаруживаются в крови и тканевых жидкостях в аморфной глобулярной форме с очень тонкими или отсутствующими мембранами. Коллагеновые белки находятся в соединительной ткани, такой как кожа или клеточные мембраны. Волокнистые белки содержатся в волосах, мышцах и соединительной ткани. Кристаллические белки представлены хрусталиком глаза и подобными тканями. Ферменты — это белки с определенными химическими функциями, которые опосредуют большинство физиологических процессов жизни. Несколько небольших полипептидов действуют как гормоны в тканевых системах, контролирующих различные химические или физиологические процессы.Мышечный белок состоит из нескольких форм полипептидов, которые позволяют мышцам сокращаться и расслабляться при физических движениях.

1.3 Недвижимость

Белки также можно охарактеризовать по их химическим реакциям. Большинство белков растворимы в воде, спирте, разбавленной основе или в различных концентрациях солевых растворов. Белки имеют характерную спиральную структуру, которая определяется последовательностью аминокислот в первичной полипептидной цепи и стереоконфигурацией радикальных групп, присоединенных к альфа-углероду каждой аминокислоты.Белки термолабильны, проявляя различную степень лабильности в зависимости от типа белка, раствора и температурного профиля. Белки могут быть обратимыми или необратимыми, денатурированными при нагревании, концентрации соли, замораживании, ультразвуковом воздействии или старении. Белки подвергаются характерному связыванию с другими белками в так называемой пластеиновой реакции и соединяются со свободными альдегидными и гидроксильными группами углеводов с образованием соединений типа Майяра.

1.4 Химическое определение

Содержание азота в большинстве белков, обнаруженных в тканях животных, орехов и зерна, составляет около 16 процентов; поэтому содержание белка обычно выражается как содержание азота × 6.25.

Проглоченные белки сначала расщепляются на более мелкие фрагменты пепсином в желудке или трипсином или химотрипсином из поджелудочной железы. Эти пептиды затем дополнительно восстанавливаются под действием карбоксипептидазы, которая гидролизует одну аминокислоту за раз, начиная со свободного карбоксильного конца молекулы, или с помощью аминопептидазы, которая отщепляет одну аминокислоту за раз, начиная со свободного амино-конца полипептида. цепь. Свободные аминокислоты, высвобождаемые в пищеварительную систему, затем всасываются через стенки желудочно-кишечного тракта в кровоток, где они затем повторно синтезируются в новые тканевые белки или катаболизируются для получения энергии или фрагментов для дальнейшего тканевого метаболизма.

Валовая потребность в белке была определена для нескольких видов рыб (см. Таблицу 1). Имитация цельного яичного протеина в тестовых диетах содержит избыток незаменимых аминокислот. Эти диеты поддерживались приблизительно изокалорийными за счет корректировки общего белка и усвояемых углеводных компонентов до фиксированного количества, поскольку лечение белковыми диетами варьировалось в испытанных диапазонах. Испытания на кормлении мальков, сеголетков и годовалых рыб показали, что общие потребности в белке наиболее высоки у начальных кормовых мальков и что они уменьшаются по мере увеличения размера рыбы.Чтобы расти с максимальной скоростью, мальки должны иметь диету, в которой почти половина легкоусвояемых ингредиентов состоит из сбалансированного белка; через 6-8 недель это требование снижается примерно до 40 процентов рациона лосося и форели и примерно до 35 процентов рациона годовалых лососевых, выращенных при стандартной температуре окружающей среды (SET). См. Рисунки 1 и 2. Общие потребности в белке молоди сома, по-видимому, меньше, чем у лососевых. Первоначально кормление мальков требует, чтобы около 50 процентов усвояемых компонентов рациона составлял белок, и потребность в них уменьшается с увеличением размера.Некоторые испытания кормления лососем показали прямую связь между изменениями потребности в белке молоди рыбы и изменениями температуры воды. Лосось чавычи в воде с температурой 7 ° C требует около 40 процентов цельного яичного белка для максимального роста; той же рыбе в воде с температурой 15 ° C требуется около 50% белка. Лосось, форель и сом могут использовать больше белка, чем требуется для максимального роста, благодаря эффективному удалению азотистых отходов в виде растворимых соединений аммиака через ткань жабр непосредственно в водную среду.Эта система удаления азота более эффективна, чем система, доступная для птиц и млекопитающих. Птица и млекопитающие потребляют энергию для синтеза мочевины, мочевой кислоты или других соединений азота, которые выводятся через ткань почек и выводятся с мочой. Перевариваемые углеводы и жиры сохранят избыток белка в рационе до тех пор, пока удовлетворяются потребности в белке для максимального роста (рисунки 1 и 2).

Таблица 1 — Расчетная потребность в белках с пищей для некоторых видов рыб 1/

Виды

Уровень сырого протеина в рационе для оптимального роста (г / кг)

Форель радужная ( Salmo gairdneri )

400-460

Карп ( Cyprinus carpio )

380

Чавыча ( Oncorhynchus tshawytscha )

400

Угорь ( Ангилья японский )

445

Камбала ( Pleuronectes platessa )

500

Золотистый лещ ( Chrysophrys aurata )

400

Белый амур ( Ctenopharyngodon idella )

410-430

Brycon sp.

356

Морской лещ ( Chrysophrys major )

550

Желтохвост ( Seriola quinqueradiata )

550

1/ По материалам C.B. Cowey, 1978

Рис. 1. Потребность в белке чавычи при 47 ° F. Верхняя кривая: начальный индивидуальный средний вес рыбы, 1.5г. Нижняя кривая: исходная индивидуальная средняя масса рыбы 5,6 г.

Рис. 2. Потребность в белке чавычи при температуре 58 ° F. Верхняя кривая: исходный индивидуальный средний вес рыбы 2,6 г. Нижняя кривая: исходная индивидуальная средняя масса рыбы 5,8 г.

(Оба рисунка адаптированы из: DeLong, D.C., J.E. Halver and E.T. Mertz, 1958, J.Nutr ., 65: 589-99)

Обычно рыбе нужно давать диету, содержащую градуированные уровни высококачественного белка и энергии и адекватный баланс незаменимых жирных кислот, витаминов и минералов в течение длительного периода времени.Из полученной кривой доза / ответ потребность в белке обычно получают по графику Альмквиста. Считается, что эти различия в очевидной потребности в белке связаны с различиями в методах культивирования и составе рациона.

Относительно высокий уровень пищевого белка, необходимый для максимального роста некоторых рыб, таких как белый амур, Ctenopharyngodon idella, и Brycon spp. удивительны, поскольку эти рыбы всеядны. Brycon spp.выращиваются на нежелательных фруктах и ​​другом растительном материале с низким содержанием белка, и в этих условиях, по-видимому, существенный вклад в потребление ими белка вносит естественная пищевая цепь.

Потребность в белке эвриталинных рыб, таких как радужная форель, Salmo gairdneri, и кижуч, Oncorhynchus кисач, , выращенных в воде с соленостью 20 ppt, примерно такая же, как потребность в пресной воде. Нет данных о потребности этих видов в белке в морской воде с полной концентрацией.(35 п.


4.1 Essential и заменимые аминокислоты
4.2 Незаменимые Аминокислоты и качество протеина


Аминокислоты являются строительными блоками белков; около 23 аминокислот были выделены из природных белков. Десять из них незаменимы для рыб. Животное не способно синтезировать незаменимые аминокислоты и поэтому должно получать их с пищей.

4.1 Незаменимые и заменимые аминокислоты

Корм ​​для лосося, форели и канального сома, лишенный аргинина, гистидина, изолейцина, лейцина, лизина, метионина, фенилаланина, треонина, триптофана или валина, не рос (рис.3). Те же самые рыбы, которых кормили рационами, лишенными других L-аминокислот, росли так же, как и рыбы, получавшие все 18 протестированных аминокислот (рис. 4). Азотный компонент в тестируемых диетах состоял из 18 L-аминокислот по образцу, обнаруженному в цельном яичном протеине. Вся тестируемая рыба быстро выздоравливала, когда в рационе была заменена недостающая аминокислота. Наклон кривой роста в группе восстановления был идентичен таковому у рыб, получавших полный тест на аминокислотный рацион.

Испытывали незаменимые аминокислоты: аланин, аспарагиновая кислота, цистин, глутаминовая кислота, глицин, пролин, серин и тирозин.Было обнаружено, что эти аминокислоты не являются необходимыми для роста лосося, форели и канального сома.

Для количественных исследований потребности в 10 незаменимых аминокислотах использовалась смесь казеина и желатина с добавлением кристаллических L-аминокислот. Тестируемая диета содержала 40 процентов цельного яичного белка для азотного компонента. Эксперименты, проведенные с карпом и угрем, показали аналогичное отсутствие роста, когда в рационе отсутствовала незаменимая аминокислота.

Рис. 3. Рост рыб с дефицитом аргинина. Группа с дефицитом была разделена через шесть недель на диете с дефицитом, и недостающая аминокислота была заменена в одной из двух частей.

Рис. 4. Рост рыб с дефицитом цистина.

(Оба рисунка взяты из: DeLong, D.C., J.E. Halver and E.T. Mertz, 1958, J.Nutr., 65: 589-99)

4.2 Основные аминокислоты и качество белка

Если известны потребности рыбы в незаменимых аминокислотах, должно быть возможно удовлетворить эти потребности в системах культивирования различными способами за счет различных пищевых белков или комбинаций пищевых белков.

Фенилаланин избавлен от тирозина. Неизвестно, что он химически модифицирован или становится недоступным из-за суровых условий, которым обычно подвергаются кормовые белки во время обработки. Измерение фенилаланина в белках несложно, поэтому обеспечение и оценка фенилаланина в белках в практических диетах не представляет особых трудностей.

Лизин — основная аминокислота. В дополнение к -аминокислотной группе, обычно связанной пептидной связью, он также содержит вторую -аминогруппу.Эта альфа-аминогруппа должна быть свободной и реакционной, иначе лизин, хотя и поддается химическому измерению, не будет доступен биологически. Во время обработки белков корма α-аминогруппа лизина может реагировать с небелковыми молекулами, присутствующими в корме, с образованием дополнительных соединений, которые делают лизин биологически недоступным.

Цистин избавлен от метионина. Однако измерить содержание метионина в кормовых белках непросто, поскольку аминокислота подвержена окислению во время обработки.После обработки метионин может присутствовать как таковой, или в виде сульфоксида, или в виде сульфона. Сульфоксид может образовываться из метионина во время кислотного гидролиза кормового белка перед измерением его кислотного состава, не содержащего кислоты. Кислотный гидролиз белков перед анализом нарушает исходное равновесие между двумя соединениями, так что состав гидролизата больше не отражает состав белка. При определении содержания метионина в чистых белках окисление аминокислоты до метионинсульфона обычно является количественным.В случае кормовых белков, однако, это не покажет, сколько метионина или сульфоксида метионина присутствовало в белке до его окисления и гидролиза.

Сульфоксид метионина может иметь некоторую биологическую ценность для рыб, которые могут иметь некоторую способность обратного преобразования его в метионин и, таким образом, частично восполнять часть метионина, окисленного во время обработки.

Недавно появились сообщения о методах измерения метионина в белках с использованием йодоплатинатного реагента до и после восстановления трихлоридом титана, чтобы получить значения как для метионина, так и для сульфоксида в исходном белке.Также был описан способ измерения метионина конкретно по расщеплению цианогенбромида. Оба метода еще предстоит оценить независимо. Микробиологический анализ метионина в белках кормов является ценным инструментом, хотя существует опасность того, что оксиды метионина могут различаться по своей активности в отношении микроорганизмов и искажать значения.

Количественные потребности лососевых в десяти незаменимых аминокислотах определялись путем кормления линейными приращениями одной аминокислоты за раз в тестируемой диете, содержащей аминокислотный профиль, идентичный цельному яичному белку, за исключением тестируемой аминокислоты.Повторяющиеся группы рыб подвергались диетическому лечению до тех пор, пока не появились большие различия в росте опытных партий. График реакции роста Альмквиста показывает уровень аминокислот, необходимый для максимального роста в этих конкретных условиях испытания. Рационы были разработаны так, чтобы содержать белок на уровне или немного ниже оптимальной потребности в белке для данного вида и условий испытаний, чтобы гарантировать максимальное использование ограничивающей аминокислоты. Сравнение требований к десяти незаменимым аминокислотам между видами показано в таблице 2.

Недавним нововведением стало использование в тестовых диетах белков, относительно дефицитных по данной незаменимой аминокислоте. Таким образом, комбинации рыбной муки и зеина использовались в тестовых диетах для определения потребности радужной форели в аргинине. Рационы, содержащие различные относительные количества казеина и желатина, показали, что увеличение уровня связанного с белком аргинина с 11 до 17 г / кг привело к значительному увеличению роста канального сома.

Таблица 2 Потребность семи животных в аминокислотах 1/

Аминокислота

Молодь угря

Мальки карпа

Канальный сом

Молодь чавычи

Цыпленок

Молодой поросенок

Крыса

Аргинин

3.9 (1,7 / 42)

4,3 (1,65 / 38,5)

6,0 (2,4 / 40)

6,1 (1,1 / 18)

1,5 (0,2 / 13)

1,0 (0,2 / 19)

Гистидин

1,9 (0,8 / 42)

1,8 (0,7 / 40)

1,7 (0,3 / 18)

1.5 (0,2 / 13)

2,1 (0,4 / 19)

Изолейцин

3,6 (1,5 / 42)

2,6 (1,0 / 38,5)

2,2 (0,9 / 41)

4,4 (0,8 / 18)

4,6 (0,6 / 13)

3,9 (0,5 / 13)

лейцин

4.1 (1,7 / 42)

3,9 (1,5 / 38,5)

3,9 (1,6 / 41)

6,7 (1,2 / 18)

4,6 (0,6 / 13)

4,5 (0,9 / 19)

Лизин

4,8 (2,0 / 42)

5,1 (1,23 / 24,0)

5,0 (2,0 / 40)

6.1 (1.1 / 18)

4,7 (0,65 / 13)

5,4 (1,0 / 19)

Метионин 2/

4,5 (2,1 / 42) 3/

3,1 (1,2 / 38,5)

2,3 (0,56 / 24,0)

4,0 (1,6 / 40) 3/

4.4 (0,8 / 18)

3,0 (0,6 / 20)

3,0 (0,6 / 20)

Фенилаланин 4/

5,1 (2,1 / 41) 5/

7,2 (1,3 / 18)

3.6 (0,45 / 13)

5,3 (0,9 / 17)

Треонин

3,6 (1,5 / 42)

2,2 (0,9 / 40)

3,3 (0,6 / 18)

3,0 (0,4 / 13)

3,1 (0,2 / 19)

Триптофан

1,0 (0,4 / 42)

0.5 (0,2 / 40)

1,1 (0,2 / 18)

0,8 (0,2 / 25)

1,0 (0,2 / 19)

Валин

3,6 (1,5 / 42)

3,2 (1,3 / 40)

4,4 (0,8 / 18)

3,1 (0,4 / 13)

3,1 (0,4 / 13)

1/ Выражается в процентах от диетического белка.В скобках числители — это потребности в процентах от сухого рациона, а знаменатели — это процент общего содержания белка в рационе.

2/ При отсутствии цистина

3/ Метионин плюс цистин

4/ При отсутствии tyro sine

5/ Фенилаланин плюс тирозин

(по материалам: Национальный исследовательский совет, 1977 г.)

Потребность радужной форели в аргинине была определена по стандартной кривой доза / реакция (рост), а также путем измерения уровней свободного аргинина в тканях (крови и мышцах) в группах форели, получавших возрастающее количество аргинина в рационе.После того, как диетическая потребность форели в аргинине была удовлетворена, любое дальнейшее увеличение потребления аргинина привело к увеличению концентрации свободного аргинина в крови и мышцах. Было получено хорошее согласие между двумя методами.

Данные, представленные в таблице 2, позволяют предположить, что между видами рыб существуют реальные различия в их потребностях в определенных аминокислотах. Это приводит к трудностям при составлении белкового компонента практического рациона для тех видов, потребности которых в аминокислотах еще не известны.Возможное решение — использовать для каждой аминокислоты наивысший уровень, необходимый для любого из тех видов, по которым имеются данные. Необходимость дополнительных количественных данных о потребностях рыб в аминокислотах, особенно тех, которые действительно или потенциально могут использоваться в качестве сельскохозяйственных животных, очевидна.

Одним из решений использования белков, относительно дефицитных по одной или нескольким аминокислотам, является добавление к белку соответствующих количеств аминокислоты, необходимых в практических диетах. Рыба, по-видимому, использует свободные аминокислоты с разной степенью эффективности.

Молодой карп, Cyprinus carpio, оказался неспособным расти на диетах, в которых белковый компонент (казеин, желатин) был заменен смесью аминокислот, аналогичных по общему составу. Гидролизат трипсина казеина также оказался неэффективным. Однако, если диета, содержащая свободные аминокислоты в качестве белкового компонента, тщательно нейтрализуется NaOH до pH 6,5-6,7, то некоторый рост молоди карпа действительно происходит. Этот рост был заметно ниже, чем при сопоставимой казеиновой диете в тех же условиях.

Канальный сом также не может использовать свободные аминокислоты в качестве добавок к дефицитным белкам. Когда соевый шрот был заменен изоназотом на муку менхадена, рост и эффективность корма канального сома были значительно снижены. Добавление свободного метионина, цистина или лизина, наиболее ограничивающих аминокислот, к этим соевым заменителям не привело к увеличению веса.

Повышение уровня аргинина в рационах сома с 11 до 17 г / кг путем изонитрогенной замены желатина на казеин значительно увеличивало прибавку в весе, но добавление свободного аргинина, цистина, триптофана или метионина к казеину мало влияло на рост или преобразование пищи.

Лососевые могут использовать свободные аминокислоты для роста. Было показано, что зеин-желатиновая диета с добавлением лизина и тритофана заметно превосходит зеин-желатиновую диету для радужной форели, когда в качестве критериев использовались прибавка в весе и использование белка.

Несколько исследователей продемонстрировали возможность дополнения белков с дефицитом аминокислот ограничивающими аминокислотами в рационах лососевых. Казеин с добавкой шести аминокислот давал коэффициенты конверсии корма для атлантического лосося, аналогичные тем, которые были получены при использовании изолированного рыбного белка в качестве источника пищевого белка.Соевый шрот с добавлением пяти или более аминокислот (включая метионин и лизин) был лучшим источником белка для радужной форели по сравнению с соевым шротом. Однако однократное добавление метионина и лизина не привело к повышению ценности соевого шрота. Эти результаты позволяют предположить, что аминокислотный спектр выделенного рыбьего белка, который они использовали, может приблизительно соответствовать потребности в аминокислотах радужной форели. Пищевая ценность изолята соевого белка может быть увеличена путем добавления в него первой ограничивающей аминокислоты; я.е., метионин.

Рационы, содержащие в качестве белкового компонента рыбную муку, мясокостную муку, а также дрожжевую и соевую муку, можно улучшить путем одновременного добавления цистина (10 г / кг) и триптофана (5 г / кг). Рыбную муку можно полностью заменить без снижения конверсии корма в рационах для радужной форели смесью из субпродуктов домашней птицы и перьевой муки вместе с 17 г лизина HCL / кг, 4,8 г DL-метионина / кг и 1,44 г DL. -триптофан / кг.

Коуи, К.Б. и Дж. Р. Сардженты, 1972 Кормление рыб. Adv. Mar.Biol., 10: 383-492

Cowey, C.B., 1979 Потребности рыб в белках и аминокислотах. В Технология кормления и кормления рыб, под редакцией Дж. Э. Халвера и К. Тьюса. Материалы Всемирного симпозиума, спонсируемого EIFAC / FAO, ICES и IUNS, Гамбург, 20-23 июня 1978 г. Schr . Bundesforschungsanst . Fisch ., Hamb ., (14/15) vol. 1: 3-16

Мерц, Э.Т., 1972 г. Потребности в белке и аминокислотах. В Питание рыб, под редакцией Дж. Э. Халвера. Нью-Йорк, Academic Press, стр. 106-43.

Национальный исследовательский совет, Подкомитет по тепловодным рыбам 1977 года, Потребности теплопроводных рыб в питательных веществах. Вашингтон, округ Колумбия, Национальная академия наук (потребности домашних животных в питательных веществах) 78 стр.


.

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *